Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165FF32

Protein Details
Accession A0A165FF32    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKDKERQQQRERERRTFPKPIPPPHNRRGDSBasic
90-109AKPARRARERPERARRLPSPBasic
NLS Segment(s)
PositionSequence
12-31RERRTFPKPIPPPHNRRGDS
90-107AKPARRARERPERARRLP
182-232RGGAGAARRVVPVRVGGVRRRRAPREGGGGRSVLRGRGERGRGERGGGNDR
Subcellular Location(s) nucl 11, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MKDKERQQQRERERRTFPKPIPPPHNRRGDSRAPHTAERRAPLPWAVPPQPNPQSSGDVHAQPLRPCACSSTCARPTIPSPSASGTGPLAKPARRARERPERARRLPSPSPGAAEGGEAELAASCRAWGAGGEERGGRGGGEGGRGRGRAAVPCSCAAVCAAERGVRGGLASPGTRVGGQGRGGAGAARRVVPVRVGGVRRRRAPREGGGGRSVLRGRGERGRGERGGGNDRAGRGGEVLDVRQGGAGLELSRAADLLLLLGGPVLPGGAVHPLLLLRHLPSTRRPHFHPWPLEPLPMLVCSMRRRGPALLLLGRSRRARGGGVLLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.85
4 0.8
5 0.8
6 0.81
7 0.82
8 0.82
9 0.83
10 0.84
11 0.82
12 0.87
13 0.78
14 0.76
15 0.73
16 0.73
17 0.71
18 0.69
19 0.7
20 0.64
21 0.69
22 0.67
23 0.68
24 0.63
25 0.58
26 0.52
27 0.44
28 0.41
29 0.37
30 0.34
31 0.32
32 0.34
33 0.35
34 0.39
35 0.42
36 0.49
37 0.53
38 0.51
39 0.5
40 0.45
41 0.44
42 0.4
43 0.4
44 0.35
45 0.29
46 0.31
47 0.31
48 0.32
49 0.28
50 0.34
51 0.3
52 0.28
53 0.27
54 0.29
55 0.26
56 0.26
57 0.29
58 0.33
59 0.36
60 0.37
61 0.38
62 0.36
63 0.38
64 0.43
65 0.4
66 0.31
67 0.29
68 0.28
69 0.29
70 0.27
71 0.25
72 0.18
73 0.2
74 0.18
75 0.21
76 0.22
77 0.22
78 0.29
79 0.35
80 0.44
81 0.46
82 0.51
83 0.55
84 0.63
85 0.72
86 0.75
87 0.79
88 0.79
89 0.78
90 0.82
91 0.77
92 0.74
93 0.7
94 0.65
95 0.6
96 0.51
97 0.47
98 0.39
99 0.35
100 0.26
101 0.21
102 0.16
103 0.1
104 0.08
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.04
115 0.03
116 0.06
117 0.1
118 0.11
119 0.12
120 0.12
121 0.12
122 0.13
123 0.12
124 0.09
125 0.05
126 0.06
127 0.06
128 0.09
129 0.1
130 0.11
131 0.12
132 0.13
133 0.13
134 0.13
135 0.13
136 0.13
137 0.16
138 0.16
139 0.17
140 0.17
141 0.18
142 0.16
143 0.15
144 0.12
145 0.1
146 0.08
147 0.07
148 0.07
149 0.07
150 0.08
151 0.08
152 0.08
153 0.06
154 0.06
155 0.06
156 0.06
157 0.07
158 0.07
159 0.06
160 0.07
161 0.07
162 0.07
163 0.07
164 0.08
165 0.09
166 0.1
167 0.1
168 0.1
169 0.1
170 0.09
171 0.1
172 0.09
173 0.08
174 0.08
175 0.08
176 0.08
177 0.09
178 0.09
179 0.09
180 0.1
181 0.1
182 0.14
183 0.16
184 0.23
185 0.31
186 0.37
187 0.43
188 0.5
189 0.52
190 0.52
191 0.55
192 0.53
193 0.55
194 0.53
195 0.48
196 0.43
197 0.4
198 0.36
199 0.33
200 0.29
201 0.2
202 0.19
203 0.17
204 0.19
205 0.25
206 0.27
207 0.29
208 0.33
209 0.37
210 0.36
211 0.36
212 0.36
213 0.33
214 0.35
215 0.31
216 0.29
217 0.26
218 0.25
219 0.24
220 0.22
221 0.18
222 0.12
223 0.11
224 0.11
225 0.1
226 0.1
227 0.1
228 0.1
229 0.09
230 0.09
231 0.09
232 0.06
233 0.06
234 0.07
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.05
242 0.05
243 0.04
244 0.04
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.02
253 0.02
254 0.02
255 0.03
256 0.05
257 0.06
258 0.06
259 0.06
260 0.07
261 0.08
262 0.09
263 0.1
264 0.09
265 0.15
266 0.17
267 0.19
268 0.28
269 0.38
270 0.45
271 0.5
272 0.54
273 0.59
274 0.67
275 0.74
276 0.74
277 0.69
278 0.7
279 0.66
280 0.63
281 0.53
282 0.45
283 0.37
284 0.29
285 0.25
286 0.17
287 0.2
288 0.22
289 0.28
290 0.31
291 0.33
292 0.35
293 0.36
294 0.39
295 0.4
296 0.43
297 0.41
298 0.41
299 0.44
300 0.44
301 0.48
302 0.46
303 0.43
304 0.39
305 0.36
306 0.34
307 0.32
308 0.36