Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DAM3

Protein Details
Accession A0A165DAM3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-67TSPCNLRYKCKHRAIRWILRTEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, plas 9, mito 2
Family & Domain DBs
Amino Acid Sequences MFAQYAVALTVLTSLVAYVSAFQDTPGPACAPVGSACSGNVFLLQTSPCNLRYKCKHRAIRWILRTEWLLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.06
9 0.06
10 0.08
11 0.08
12 0.1
13 0.1
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.08
25 0.08
26 0.07
27 0.07
28 0.06
29 0.05
30 0.06
31 0.07
32 0.07
33 0.08
34 0.11
35 0.13
36 0.2
37 0.21
38 0.29
39 0.39
40 0.46
41 0.55
42 0.63
43 0.7
44 0.69
45 0.79
46 0.8
47 0.81
48 0.81
49 0.77
50 0.68
51 0.64
52 0.61