Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165D539

Protein Details
Accession A0A165D539    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
186-207GGYSEPASARRRRRRTWSSGCHHydrophilic
NLS Segment(s)
PositionSequence
197-197R
Subcellular Location(s) cyto 21, cyto_nucl 15, nucl 5
Family & Domain DBs
Amino Acid Sequences MAKGLLADAEKATTNGAGYATGHPPVVNGGISETEKLAHESGADGQTMQSIKAVGTAAVFTEEVVDAFKDRKASRAALKKDGEKLAIAGARAVLVTAKAVEDEEKSDGDETGDAANMEGGGNLANGENGCDEPTDGKVTNSGNGANGAYDAKGANGGYAGDGGDAGDGGDGGDAGYVGDASDAACGGYSEPASARRRRRRTWSSGCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.1
6 0.13
7 0.15
8 0.15
9 0.15
10 0.14
11 0.14
12 0.15
13 0.14
14 0.11
15 0.09
16 0.09
17 0.12
18 0.13
19 0.13
20 0.12
21 0.11
22 0.12
23 0.14
24 0.13
25 0.1
26 0.1
27 0.1
28 0.13
29 0.13
30 0.13
31 0.11
32 0.1
33 0.13
34 0.13
35 0.12
36 0.09
37 0.08
38 0.08
39 0.1
40 0.1
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.08
56 0.12
57 0.12
58 0.16
59 0.19
60 0.23
61 0.3
62 0.39
63 0.42
64 0.45
65 0.48
66 0.48
67 0.5
68 0.48
69 0.4
70 0.31
71 0.27
72 0.21
73 0.19
74 0.15
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.05
89 0.06
90 0.07
91 0.07
92 0.07
93 0.08
94 0.08
95 0.07
96 0.07
97 0.06
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.08
121 0.1
122 0.1
123 0.1
124 0.13
125 0.13
126 0.15
127 0.15
128 0.14
129 0.12
130 0.12
131 0.12
132 0.09
133 0.09
134 0.08
135 0.07
136 0.07
137 0.06
138 0.06
139 0.07
140 0.07
141 0.06
142 0.06
143 0.06
144 0.05
145 0.06
146 0.06
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.07
175 0.07
176 0.08
177 0.1
178 0.18
179 0.24
180 0.33
181 0.43
182 0.52
183 0.61
184 0.69
185 0.78
186 0.81
187 0.85