Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XAQ9

Protein Details
Accession G2XAQ9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-37HAKLRYTKFLKRRRTIIRKADQLHHydrophilic
NLS Segment(s)
PositionSequence
13-27HHAKLRYTKFLKRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
KEGG vda:VDAG_07390  -  
Amino Acid Sequences MPASRSPLESRRHHAKLRYTKFLKRRRTIIRKADQLHKDCQVRVYVYMELNGKSWVYDTMLGDASFPPSKIDQVRLYPIPQVFTPKDLPSTKQSEPCASAEDYQED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.71
4 0.73
5 0.75
6 0.71
7 0.73
8 0.77
9 0.79
10 0.8
11 0.75
12 0.77
13 0.77
14 0.82
15 0.83
16 0.83
17 0.83
18 0.81
19 0.79
20 0.79
21 0.76
22 0.69
23 0.63
24 0.59
25 0.53
26 0.45
27 0.42
28 0.35
29 0.28
30 0.26
31 0.24
32 0.19
33 0.17
34 0.18
35 0.17
36 0.15
37 0.15
38 0.14
39 0.11
40 0.09
41 0.09
42 0.07
43 0.07
44 0.08
45 0.08
46 0.09
47 0.11
48 0.1
49 0.11
50 0.1
51 0.12
52 0.11
53 0.11
54 0.1
55 0.1
56 0.14
57 0.15
58 0.19
59 0.2
60 0.23
61 0.28
62 0.28
63 0.29
64 0.3
65 0.29
66 0.27
67 0.24
68 0.28
69 0.24
70 0.26
71 0.29
72 0.26
73 0.32
74 0.31
75 0.34
76 0.34
77 0.4
78 0.41
79 0.44
80 0.46
81 0.45
82 0.46
83 0.44
84 0.42
85 0.37
86 0.35