Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IL90

Protein Details
Accession A0A165IL90    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-126DATARTEKQKKKDTHFGKRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
86-121LRAKKTRAIRRRLSHTDATARTEKQKKKDTHFGKRK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSASNKIKAYELRSKGKADLQKQLTELRTELGTLRVQKIAGGSAAKLTKINTVRKSIARVLTITNQKARQNIREYYKDKKHLPLDLRAKKTRAIRRRLSHTDATARTEKQKKKDTHFGKRKYAVKALE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.55
4 0.56
5 0.5
6 0.53
7 0.49
8 0.48
9 0.48
10 0.5
11 0.44
12 0.39
13 0.34
14 0.26
15 0.22
16 0.19
17 0.18
18 0.15
19 0.17
20 0.17
21 0.19
22 0.18
23 0.18
24 0.18
25 0.17
26 0.15
27 0.13
28 0.11
29 0.09
30 0.12
31 0.13
32 0.12
33 0.13
34 0.12
35 0.17
36 0.22
37 0.29
38 0.29
39 0.33
40 0.36
41 0.37
42 0.41
43 0.38
44 0.36
45 0.3
46 0.27
47 0.25
48 0.27
49 0.3
50 0.28
51 0.27
52 0.28
53 0.29
54 0.33
55 0.33
56 0.33
57 0.34
58 0.37
59 0.4
60 0.44
61 0.46
62 0.5
63 0.55
64 0.56
65 0.54
66 0.56
67 0.54
68 0.52
69 0.53
70 0.54
71 0.57
72 0.58
73 0.63
74 0.6
75 0.58
76 0.56
77 0.61
78 0.62
79 0.6
80 0.61
81 0.63
82 0.67
83 0.75
84 0.78
85 0.75
86 0.7
87 0.66
88 0.66
89 0.58
90 0.56
91 0.51
92 0.46
93 0.48
94 0.52
95 0.54
96 0.55
97 0.63
98 0.65
99 0.69
100 0.78
101 0.79
102 0.81
103 0.84
104 0.84
105 0.84
106 0.85
107 0.83
108 0.8