Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165H923

Protein Details
Accession A0A165H923    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPGGGRLKLKPLEBasic
NLS Segment(s)
PositionSequence
3-19KRKKSSRKPGGGRLKLK
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPGGGRLKLKPLETTFQCLFCHHNDSVVCKLDKTEGLGQLHCKICGQRFSCTVNYLSEPIDVYSEWIDASEKAQDRRQPVRKQRPVAIEEEDDDEPRAMTPLGDEEDYDDEGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.82
3 0.81
4 0.74
5 0.67
6 0.62
7 0.55
8 0.53
9 0.48
10 0.48
11 0.4
12 0.39
13 0.38
14 0.33
15 0.32
16 0.26
17 0.3
18 0.22
19 0.25
20 0.23
21 0.27
22 0.3
23 0.31
24 0.29
25 0.23
26 0.24
27 0.22
28 0.21
29 0.22
30 0.22
31 0.22
32 0.23
33 0.24
34 0.25
35 0.29
36 0.29
37 0.24
38 0.21
39 0.18
40 0.19
41 0.25
42 0.25
43 0.23
44 0.25
45 0.29
46 0.29
47 0.29
48 0.27
49 0.21
50 0.2
51 0.18
52 0.16
53 0.12
54 0.11
55 0.1
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.06
63 0.07
64 0.06
65 0.07
66 0.11
67 0.14
68 0.16
69 0.21
70 0.24
71 0.3
72 0.4
73 0.49
74 0.54
75 0.63
76 0.71
77 0.76
78 0.78
79 0.79
80 0.77
81 0.71
82 0.65
83 0.58
84 0.48
85 0.41
86 0.39
87 0.33
88 0.26
89 0.24
90 0.2
91 0.15
92 0.14
93 0.13
94 0.09
95 0.08
96 0.08
97 0.11
98 0.14
99 0.14
100 0.13
101 0.15
102 0.18