Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165EL23

Protein Details
Accession A0A165EL23    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-45GIPKAQKRRVKFGRWRKRRRHKSSFVAESLBasic
NLS Segment(s)
PositionSequence
18-37PKAQKRRVKFGRWRKRRRHK
Subcellular Location(s) plas 8, cyto_nucl 5, nucl 4.5, cyto 4.5, mito 4, E.R. 3
Family & Domain DBs
Amino Acid Sequences MGRVVEVSESEKGLEGIPKAQKRRVKFGRWRKRRRHKSSFVAESLECVSFLVSFLLWADERDSWRIKRCGLYYNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.17
4 0.24
5 0.3
6 0.34
7 0.41
8 0.45
9 0.47
10 0.57
11 0.59
12 0.62
13 0.66
14 0.74
15 0.78
16 0.83
17 0.9
18 0.9
19 0.93
20 0.94
21 0.94
22 0.93
23 0.91
24 0.89
25 0.87
26 0.82
27 0.72
28 0.63
29 0.53
30 0.44
31 0.36
32 0.27
33 0.17
34 0.11
35 0.1
36 0.07
37 0.07
38 0.06
39 0.04
40 0.04
41 0.05
42 0.07
43 0.07
44 0.07
45 0.09
46 0.11
47 0.14
48 0.18
49 0.23
50 0.25
51 0.34
52 0.37
53 0.39
54 0.44
55 0.45