Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165I6H7

Protein Details
Accession A0A165I6H7    Localization Confidence High Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-54MVRIRKKSSKRGKTHLRERVKHKVTEHRRKSKKEAKKNPQWKSRHKKDPGIPNSBasic
66-113AEERRLRRSSRSARRPRRRQRRGRQLRFQRRKRRSFRRTGRRELRIWPBasic
NLS Segment(s)
PositionSequence
4-50IRKKSSKRGKTHLRERVKHKVTEHRRKSKKEAKKNPQWKSRHKKDPG
68-115ERRLRRSSRSARRPRRRQRRGRQLRFQRRKRRSFRRTGRRELRIWPGS
121-123RRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MVRIRKKSSKRGKTHLRERVKHKVTEHRRKSKKEAKKNPQWKSRHKKDPGIPNSLPFKAEILAEIAEERRLRRSSRSARRPRRRQRRGRQLRFQRRKRRSFRRTGRRELRIWPGSESPPCRRRPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.9
4 0.88
5 0.86
6 0.87
7 0.82
8 0.77
9 0.72
10 0.72
11 0.73
12 0.76
13 0.78
14 0.78
15 0.81
16 0.83
17 0.87
18 0.86
19 0.86
20 0.86
21 0.87
22 0.87
23 0.89
24 0.92
25 0.91
26 0.9
27 0.88
28 0.88
29 0.87
30 0.87
31 0.86
32 0.82
33 0.82
34 0.8
35 0.82
36 0.76
37 0.74
38 0.64
39 0.58
40 0.55
41 0.47
42 0.4
43 0.29
44 0.24
45 0.16
46 0.15
47 0.11
48 0.08
49 0.07
50 0.07
51 0.07
52 0.06
53 0.08
54 0.09
55 0.09
56 0.12
57 0.14
58 0.16
59 0.2
60 0.3
61 0.39
62 0.49
63 0.6
64 0.66
65 0.75
66 0.85
67 0.92
68 0.93
69 0.94
70 0.94
71 0.95
72 0.95
73 0.95
74 0.95
75 0.95
76 0.94
77 0.94
78 0.95
79 0.95
80 0.94
81 0.94
82 0.93
83 0.93
84 0.93
85 0.93
86 0.92
87 0.92
88 0.92
89 0.92
90 0.91
91 0.92
92 0.91
93 0.88
94 0.81
95 0.76
96 0.75
97 0.71
98 0.63
99 0.57
100 0.51
101 0.49
102 0.53
103 0.53
104 0.53
105 0.55