Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165GHP8

Protein Details
Accession A0A165GHP8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-61QYIPPLSQTQRKEKKRKEGGTYRLPSHydrophilic
NLS Segment(s)
PositionSequence
47-52KEKKRK
Subcellular Location(s) nucl 15, cyto_nucl 11.333, mito_nucl 9.833, cyto 6.5, mito 3.5
Family & Domain DBs
Amino Acid Sequences MDELGSTHGRLELCQAGLHLAHTPLFPPLPQPTIDQYIPPLSQTQRKEKKRKEGGTYRLPSPPADPQQHLRPAPQRVIPPREQPHQRPQPLTPALPHLTEQPTRLPERLRAPAQRLRPARSSPRGPADQARVLRRVPVPVLVREPREQDMEQAGGEERVVRLQVVEQLLPERGELARQRGVRQRRPFSGWGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.16
5 0.17
6 0.15
7 0.12
8 0.12
9 0.12
10 0.12
11 0.13
12 0.13
13 0.12
14 0.14
15 0.17
16 0.19
17 0.2
18 0.22
19 0.24
20 0.3
21 0.3
22 0.27
23 0.25
24 0.28
25 0.26
26 0.24
27 0.23
28 0.21
29 0.28
30 0.33
31 0.41
32 0.47
33 0.57
34 0.67
35 0.72
36 0.8
37 0.83
38 0.86
39 0.85
40 0.84
41 0.82
42 0.82
43 0.78
44 0.7
45 0.63
46 0.56
47 0.46
48 0.39
49 0.39
50 0.35
51 0.35
52 0.34
53 0.35
54 0.41
55 0.47
56 0.45
57 0.42
58 0.41
59 0.41
60 0.42
61 0.41
62 0.4
63 0.4
64 0.46
65 0.45
66 0.47
67 0.48
68 0.52
69 0.55
70 0.54
71 0.58
72 0.61
73 0.61
74 0.56
75 0.52
76 0.53
77 0.49
78 0.45
79 0.35
80 0.3
81 0.27
82 0.25
83 0.24
84 0.18
85 0.19
86 0.19
87 0.19
88 0.17
89 0.19
90 0.21
91 0.22
92 0.21
93 0.22
94 0.27
95 0.31
96 0.33
97 0.33
98 0.38
99 0.42
100 0.46
101 0.49
102 0.48
103 0.46
104 0.46
105 0.48
106 0.51
107 0.52
108 0.51
109 0.48
110 0.51
111 0.49
112 0.46
113 0.46
114 0.43
115 0.42
116 0.42
117 0.41
118 0.37
119 0.35
120 0.37
121 0.34
122 0.31
123 0.25
124 0.27
125 0.26
126 0.26
127 0.33
128 0.33
129 0.35
130 0.35
131 0.37
132 0.33
133 0.35
134 0.32
135 0.28
136 0.27
137 0.24
138 0.22
139 0.19
140 0.17
141 0.13
142 0.13
143 0.11
144 0.08
145 0.08
146 0.09
147 0.08
148 0.08
149 0.09
150 0.13
151 0.15
152 0.15
153 0.14
154 0.16
155 0.18
156 0.18
157 0.17
158 0.14
159 0.11
160 0.17
161 0.2
162 0.23
163 0.29
164 0.31
165 0.37
166 0.45
167 0.55
168 0.59
169 0.66
170 0.69
171 0.69
172 0.74