Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165FET8

Protein Details
Accession A0A165FET8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-95RFLAGKKVRKYYKRRSRRVLDQIPEHydrophilic
NLS Segment(s)
PositionSequence
70-88NRFLAGKKVRKYYKRRSRR
Subcellular Location(s) nucl 13, cyto 9.5, cyto_mito 7, mito 3.5
Family & Domain DBs
Amino Acid Sequences MNNHVDQVPEMFAEDEVSVSDYVENPDDAQDIAIQLCSMLSAAGTSVNENGDFVMDAAQLKAFAALLRRNRFLAGKKVRKYYKRRSRRVLDQIPEDDIETSLTSANRGERDKFGLGSTLRGKVVAIENKLPLSELPPSPAAADEDGAEVSMSPPAIATVEYGHSTSTDAAHSGGGGGRSDSVTGWQVILTGRSSAVPQLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.1
5 0.09
6 0.09
7 0.09
8 0.09
9 0.11
10 0.12
11 0.12
12 0.1
13 0.11
14 0.11
15 0.11
16 0.1
17 0.09
18 0.08
19 0.08
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.05
31 0.05
32 0.06
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.08
52 0.13
53 0.21
54 0.25
55 0.27
56 0.27
57 0.29
58 0.31
59 0.32
60 0.37
61 0.4
62 0.46
63 0.49
64 0.57
65 0.63
66 0.69
67 0.75
68 0.75
69 0.76
70 0.77
71 0.82
72 0.82
73 0.83
74 0.84
75 0.85
76 0.82
77 0.75
78 0.69
79 0.61
80 0.53
81 0.46
82 0.36
83 0.25
84 0.17
85 0.13
86 0.08
87 0.07
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.11
94 0.12
95 0.14
96 0.14
97 0.18
98 0.19
99 0.19
100 0.17
101 0.18
102 0.17
103 0.19
104 0.2
105 0.18
106 0.17
107 0.17
108 0.16
109 0.14
110 0.2
111 0.2
112 0.2
113 0.2
114 0.21
115 0.21
116 0.21
117 0.2
118 0.14
119 0.12
120 0.14
121 0.12
122 0.14
123 0.15
124 0.15
125 0.15
126 0.16
127 0.15
128 0.11
129 0.11
130 0.08
131 0.08
132 0.08
133 0.08
134 0.07
135 0.06
136 0.05
137 0.06
138 0.05
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.08
147 0.09
148 0.1
149 0.1
150 0.1
151 0.11
152 0.11
153 0.1
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.08
160 0.09
161 0.09
162 0.09
163 0.09
164 0.09
165 0.1
166 0.1
167 0.1
168 0.11
169 0.12
170 0.12
171 0.12
172 0.11
173 0.11
174 0.12
175 0.14
176 0.12
177 0.11
178 0.11
179 0.11
180 0.13