Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WUD1

Protein Details
Accession G2WUD1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
198-222GGERRRTEVRYKKRIAQRKAEIEASHydrophilic
NLS Segment(s)
PositionSequence
201-225RRRTEVRYKKRIAQRKAEIEASRRG
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
IPR013761  SAM/pointed_sf  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG vda:VDAG_01404  -  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MKAPQLRIPPLSAIAPRVSTVNTCQLRWASKRATPAIPQPVPLVPDVPTLLKVLGRGLSQYAEKFPTWNSLFTSDSTQMKELGIEPPRTRRYLLAWLERYRQGALGPGGDFKHVENGEAYLQVATTEAQDRKWVINVPAGQKADGAVQGPDERVRGYQVRGASAITGPYALPLKAGDGAKVQVVEGMWEHRQGIKVDGGERRRTEVRYKKRIAQRKAEIEASRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.22
4 0.21
5 0.2
6 0.18
7 0.21
8 0.27
9 0.28
10 0.27
11 0.3
12 0.33
13 0.38
14 0.4
15 0.44
16 0.39
17 0.4
18 0.48
19 0.49
20 0.5
21 0.47
22 0.51
23 0.54
24 0.49
25 0.47
26 0.42
27 0.38
28 0.35
29 0.32
30 0.24
31 0.15
32 0.16
33 0.16
34 0.15
35 0.14
36 0.13
37 0.13
38 0.13
39 0.12
40 0.11
41 0.12
42 0.11
43 0.11
44 0.11
45 0.12
46 0.13
47 0.14
48 0.15
49 0.16
50 0.16
51 0.16
52 0.16
53 0.22
54 0.22
55 0.23
56 0.22
57 0.23
58 0.24
59 0.24
60 0.28
61 0.23
62 0.23
63 0.23
64 0.22
65 0.19
66 0.18
67 0.17
68 0.14
69 0.16
70 0.19
71 0.21
72 0.22
73 0.29
74 0.32
75 0.33
76 0.33
77 0.28
78 0.28
79 0.33
80 0.38
81 0.38
82 0.41
83 0.42
84 0.44
85 0.44
86 0.41
87 0.32
88 0.27
89 0.19
90 0.17
91 0.15
92 0.13
93 0.11
94 0.12
95 0.11
96 0.11
97 0.11
98 0.08
99 0.13
100 0.12
101 0.12
102 0.11
103 0.11
104 0.12
105 0.11
106 0.11
107 0.06
108 0.06
109 0.05
110 0.05
111 0.04
112 0.05
113 0.09
114 0.09
115 0.09
116 0.11
117 0.12
118 0.13
119 0.15
120 0.16
121 0.13
122 0.18
123 0.21
124 0.23
125 0.27
126 0.27
127 0.25
128 0.23
129 0.22
130 0.18
131 0.15
132 0.13
133 0.07
134 0.08
135 0.09
136 0.09
137 0.1
138 0.09
139 0.09
140 0.09
141 0.12
142 0.13
143 0.14
144 0.17
145 0.17
146 0.18
147 0.18
148 0.18
149 0.15
150 0.14
151 0.13
152 0.09
153 0.09
154 0.07
155 0.08
156 0.09
157 0.08
158 0.08
159 0.08
160 0.09
161 0.13
162 0.14
163 0.13
164 0.13
165 0.14
166 0.15
167 0.15
168 0.14
169 0.1
170 0.1
171 0.1
172 0.09
173 0.12
174 0.12
175 0.13
176 0.14
177 0.15
178 0.18
179 0.19
180 0.21
181 0.21
182 0.22
183 0.26
184 0.33
185 0.37
186 0.41
187 0.41
188 0.44
189 0.45
190 0.46
191 0.52
192 0.55
193 0.6
194 0.64
195 0.69
196 0.72
197 0.78
198 0.85
199 0.83
200 0.83
201 0.83
202 0.81
203 0.8
204 0.79
205 0.74