Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165I1Q7

Protein Details
Accession A0A165I1Q7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MNVRRFRRRRSDAWDRSQTPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 3, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNVRRFRRRRSDAWDRSQTPWAFGLVEVEEYIGPCISNVISVFLGLQEIRFLQQSMSLCILFRISCIGASLPLLPSFGAYFLLASKDANRFMIPFLCCASSFLLSVLQPDVRCSDLLQTCILNFQQGILGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.77
3 0.73
4 0.73
5 0.64
6 0.55
7 0.46
8 0.37
9 0.27
10 0.23
11 0.21
12 0.13
13 0.13
14 0.1
15 0.1
16 0.09
17 0.08
18 0.09
19 0.07
20 0.06
21 0.05
22 0.06
23 0.05
24 0.06
25 0.06
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.08
32 0.06
33 0.06
34 0.04
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.09
41 0.1
42 0.11
43 0.13
44 0.12
45 0.11
46 0.11
47 0.12
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.09
73 0.1
74 0.11
75 0.12
76 0.12
77 0.12
78 0.13
79 0.18
80 0.16
81 0.15
82 0.16
83 0.16
84 0.16
85 0.17
86 0.18
87 0.14
88 0.13
89 0.13
90 0.14
91 0.12
92 0.13
93 0.14
94 0.14
95 0.13
96 0.14
97 0.16
98 0.15
99 0.15
100 0.15
101 0.21
102 0.21
103 0.23
104 0.23
105 0.22
106 0.21
107 0.24
108 0.24
109 0.18
110 0.14
111 0.13