Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165HUA6

Protein Details
Accession A0A165HUA6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGRHTRIRVRPKKDPAIAPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MGRHTRIRVRPKKDPAIAPCAVEMVAMLTCWSSSGDWEGRATCKSLKDSLHACMLAAGKKPPKRAPAINYHLQRLSKDFPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.73
4 0.65
5 0.56
6 0.46
7 0.37
8 0.29
9 0.2
10 0.14
11 0.08
12 0.06
13 0.05
14 0.05
15 0.04
16 0.04
17 0.05
18 0.06
19 0.04
20 0.05
21 0.08
22 0.09
23 0.1
24 0.11
25 0.11
26 0.12
27 0.13
28 0.14
29 0.12
30 0.14
31 0.15
32 0.19
33 0.19
34 0.22
35 0.24
36 0.24
37 0.26
38 0.23
39 0.21
40 0.2
41 0.2
42 0.19
43 0.18
44 0.21
45 0.25
46 0.29
47 0.36
48 0.39
49 0.44
50 0.49
51 0.54
52 0.56
53 0.59
54 0.63
55 0.65
56 0.63
57 0.62
58 0.6
59 0.54
60 0.49
61 0.45