Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165K821

Protein Details
Accession A0A165K821   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
205-225AQSERRTTPRRTPTRSRLGMSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR026010  NSP1/NUP62  
IPR007758  Nucleoporin_NSP1_C  
Gene Ontology GO:0005643  C:nuclear pore  
GO:0017056  F:structural constituent of nuclear pore  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF05064  Nsp1_C  
Amino Acid Sequences MSDVNDAERTQLLVDSSLEHVETQQKELSAALDGYESLLSSMFEKNLGSSPYKTLTSSGLDAGTGGVRDLRPADKARQDAYALAERLNRELDDMSRNLAQMIDTLNALSAAGAGGAGAGAGLSAASLSFSSSGLNPASIAAAEDPVSQIVAILNSNLGTLQWIESKTRALEDKVRQTELMVAGTAAQSAGGDGPVVASAVPAQLAQSERRTTPRRTPTRSRLGMSSNTSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.14
5 0.13
6 0.12
7 0.13
8 0.19
9 0.2
10 0.21
11 0.21
12 0.21
13 0.21
14 0.21
15 0.2
16 0.15
17 0.13
18 0.11
19 0.09
20 0.08
21 0.09
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.07
28 0.09
29 0.08
30 0.09
31 0.09
32 0.1
33 0.13
34 0.16
35 0.17
36 0.17
37 0.2
38 0.23
39 0.24
40 0.23
41 0.21
42 0.21
43 0.2
44 0.2
45 0.18
46 0.15
47 0.13
48 0.13
49 0.12
50 0.1
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.09
57 0.1
58 0.13
59 0.16
60 0.22
61 0.25
62 0.28
63 0.29
64 0.29
65 0.29
66 0.26
67 0.27
68 0.27
69 0.22
70 0.2
71 0.21
72 0.19
73 0.2
74 0.19
75 0.16
76 0.11
77 0.12
78 0.12
79 0.13
80 0.13
81 0.14
82 0.13
83 0.13
84 0.12
85 0.12
86 0.1
87 0.07
88 0.08
89 0.07
90 0.06
91 0.06
92 0.06
93 0.05
94 0.05
95 0.04
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.01
105 0.01
106 0.01
107 0.01
108 0.01
109 0.01
110 0.01
111 0.01
112 0.02
113 0.02
114 0.02
115 0.03
116 0.03
117 0.04
118 0.04
119 0.07
120 0.07
121 0.07
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.04
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.05
147 0.06
148 0.08
149 0.09
150 0.11
151 0.12
152 0.14
153 0.14
154 0.16
155 0.18
156 0.18
157 0.26
158 0.32
159 0.41
160 0.43
161 0.44
162 0.41
163 0.39
164 0.4
165 0.33
166 0.27
167 0.17
168 0.13
169 0.12
170 0.12
171 0.11
172 0.07
173 0.05
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.03
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.05
188 0.05
189 0.05
190 0.08
191 0.1
192 0.14
193 0.19
194 0.22
195 0.25
196 0.34
197 0.4
198 0.44
199 0.52
200 0.59
201 0.64
202 0.69
203 0.78
204 0.79
205 0.84
206 0.84
207 0.77
208 0.72
209 0.67
210 0.66