Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DEB3

Protein Details
Accession A0A165DEB3    Localization Confidence High Confidence Score 22.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-172DGSEKPKPKAKRAPRKKPVKEEDDEEEEPPKKKRRAPAKKVKKEEVEEBasic
190-226DEEDVKPKKRAPKKAAPKAEPKPKKARTSAEKKKAVDBasic
237-267EPEDEKPKAGEKRKRAPTKKAGEKPAPKAAKBasic
NLS Segment(s)
PositionSequence
129-167KPKPKAKRAPRKKPVKEEDDEEEEPPKKKRRAPAKKVKK
195-223KPKKRAPKKAAPKAEPKPKKARTSAEKKK
242-279KPKAGEKRKRAPTKKAGEKPAPKAAKAKPSSKAKSKAT
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0008270  F:zinc ion binding  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MSDEDGPGRKTAYRIEYAASARAKCKGPKPCSGTPIAKGLMRIGTLVDIQGHQAFQWRHFGCTTAKLMGNILKNVGEIEELDGYEDLTPEDASKIKKAFDTLTIEPEDIPESARKPPADEDEDADGSEKPKPKAKRAPRKKPVKEEDDEEEEPPKKKRRAPAKKVKKEEVEEDDDEGGDPEDGKVDEDDDEEDVKPKKRAPKKAAPKAEPKPKKARTSAEKKKAVDDALADDGELTEPEDEKPKAGEKRKRAPTKKAGEKPAPKAAKAKPSSKAKSKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.36
5 0.4
6 0.38
7 0.34
8 0.31
9 0.36
10 0.39
11 0.4
12 0.46
13 0.5
14 0.52
15 0.59
16 0.65
17 0.67
18 0.67
19 0.68
20 0.65
21 0.57
22 0.57
23 0.5
24 0.43
25 0.37
26 0.34
27 0.28
28 0.23
29 0.2
30 0.14
31 0.13
32 0.12
33 0.12
34 0.11
35 0.09
36 0.1
37 0.11
38 0.1
39 0.09
40 0.16
41 0.16
42 0.17
43 0.27
44 0.26
45 0.27
46 0.27
47 0.3
48 0.25
49 0.29
50 0.31
51 0.25
52 0.25
53 0.23
54 0.25
55 0.27
56 0.28
57 0.23
58 0.22
59 0.18
60 0.16
61 0.16
62 0.15
63 0.1
64 0.07
65 0.08
66 0.08
67 0.07
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.06
74 0.05
75 0.06
76 0.05
77 0.06
78 0.09
79 0.1
80 0.14
81 0.15
82 0.16
83 0.16
84 0.18
85 0.18
86 0.21
87 0.26
88 0.23
89 0.26
90 0.26
91 0.25
92 0.23
93 0.22
94 0.18
95 0.12
96 0.11
97 0.09
98 0.1
99 0.13
100 0.16
101 0.16
102 0.16
103 0.19
104 0.23
105 0.25
106 0.24
107 0.24
108 0.24
109 0.24
110 0.23
111 0.21
112 0.16
113 0.13
114 0.16
115 0.17
116 0.15
117 0.22
118 0.25
119 0.33
120 0.43
121 0.53
122 0.61
123 0.68
124 0.78
125 0.82
126 0.89
127 0.89
128 0.89
129 0.86
130 0.82
131 0.73
132 0.65
133 0.6
134 0.56
135 0.49
136 0.39
137 0.35
138 0.3
139 0.3
140 0.31
141 0.34
142 0.32
143 0.35
144 0.43
145 0.5
146 0.6
147 0.68
148 0.75
149 0.78
150 0.84
151 0.87
152 0.86
153 0.81
154 0.73
155 0.68
156 0.63
157 0.58
158 0.48
159 0.42
160 0.35
161 0.28
162 0.25
163 0.19
164 0.13
165 0.07
166 0.06
167 0.04
168 0.05
169 0.05
170 0.06
171 0.06
172 0.06
173 0.07
174 0.07
175 0.08
176 0.08
177 0.09
178 0.09
179 0.13
180 0.15
181 0.18
182 0.2
183 0.24
184 0.32
185 0.4
186 0.51
187 0.56
188 0.64
189 0.72
190 0.81
191 0.86
192 0.83
193 0.84
194 0.84
195 0.86
196 0.83
197 0.79
198 0.8
199 0.78
200 0.8
201 0.77
202 0.77
203 0.76
204 0.79
205 0.82
206 0.82
207 0.81
208 0.74
209 0.72
210 0.66
211 0.57
212 0.48
213 0.38
214 0.32
215 0.27
216 0.25
217 0.21
218 0.16
219 0.15
220 0.13
221 0.12
222 0.08
223 0.06
224 0.07
225 0.08
226 0.15
227 0.15
228 0.15
229 0.18
230 0.25
231 0.33
232 0.42
233 0.51
234 0.55
235 0.65
236 0.75
237 0.84
238 0.85
239 0.86
240 0.87
241 0.88
242 0.89
243 0.88
244 0.87
245 0.86
246 0.87
247 0.84
248 0.84
249 0.78
250 0.69
251 0.69
252 0.66
253 0.66
254 0.64
255 0.63
256 0.62
257 0.68
258 0.75
259 0.76