Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X4Y1

Protein Details
Accession G2X4Y1    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
119-145TESRSRPKSVAKRMKRIKARLKKTEEQHydrophilic
NLS Segment(s)
PositionSequence
122-141RSRPKSVAKRMKRIKARLKK
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
KEGG vda:VDAG_05213  -  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSCSKCQRSFPETARGQKQLRAHCRYHEGEKAYVCMSDEFVPGTQAGCGKSYVKKTTLRGHWTREKACHQGLIMLSSDLPEKLLSGDPPPRSRQAIDEAQPSSHQRREPEVTAKSGTITESRSRPKSVAKRMKRIKARLKKTEEQINYQDAGMKQAQATCTSLQEQFKLAIANQNKGFKEIKAMISRLEARLAISAASHPATPEALSWTRQPPPTRRANAGANRPLPYPNGFHEQSWPNNLALHDPQSSVNIVRPLQQGLLSHSTPPSVEAGANQSSALYQLGSRGENIDASSNISQQYNGTEIVKGVPYSSTFEVPRGGLSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.65
4 0.61
5 0.63
6 0.63
7 0.66
8 0.64
9 0.61
10 0.59
11 0.65
12 0.64
13 0.64
14 0.61
15 0.55
16 0.52
17 0.5
18 0.46
19 0.39
20 0.34
21 0.29
22 0.22
23 0.2
24 0.17
25 0.16
26 0.15
27 0.15
28 0.15
29 0.13
30 0.13
31 0.12
32 0.12
33 0.12
34 0.12
35 0.14
36 0.16
37 0.22
38 0.28
39 0.32
40 0.35
41 0.41
42 0.46
43 0.53
44 0.59
45 0.63
46 0.62
47 0.65
48 0.69
49 0.71
50 0.71
51 0.68
52 0.66
53 0.63
54 0.59
55 0.53
56 0.44
57 0.4
58 0.35
59 0.3
60 0.24
61 0.18
62 0.15
63 0.13
64 0.14
65 0.09
66 0.09
67 0.07
68 0.06
69 0.08
70 0.1
71 0.1
72 0.14
73 0.21
74 0.25
75 0.29
76 0.32
77 0.34
78 0.35
79 0.35
80 0.34
81 0.34
82 0.37
83 0.36
84 0.37
85 0.35
86 0.33
87 0.34
88 0.35
89 0.33
90 0.3
91 0.3
92 0.27
93 0.32
94 0.36
95 0.39
96 0.42
97 0.39
98 0.38
99 0.37
100 0.35
101 0.29
102 0.24
103 0.21
104 0.15
105 0.16
106 0.17
107 0.21
108 0.27
109 0.29
110 0.3
111 0.31
112 0.38
113 0.45
114 0.52
115 0.57
116 0.59
117 0.67
118 0.74
119 0.81
120 0.81
121 0.81
122 0.81
123 0.8
124 0.82
125 0.81
126 0.81
127 0.78
128 0.75
129 0.74
130 0.66
131 0.61
132 0.54
133 0.47
134 0.39
135 0.33
136 0.31
137 0.21
138 0.22
139 0.17
140 0.14
141 0.12
142 0.13
143 0.13
144 0.11
145 0.13
146 0.1
147 0.11
148 0.12
149 0.15
150 0.15
151 0.15
152 0.14
153 0.13
154 0.13
155 0.13
156 0.11
157 0.14
158 0.15
159 0.18
160 0.2
161 0.25
162 0.24
163 0.27
164 0.28
165 0.21
166 0.25
167 0.24
168 0.27
169 0.25
170 0.25
171 0.23
172 0.25
173 0.27
174 0.22
175 0.2
176 0.15
177 0.12
178 0.12
179 0.12
180 0.08
181 0.07
182 0.07
183 0.07
184 0.08
185 0.07
186 0.06
187 0.07
188 0.07
189 0.07
190 0.07
191 0.1
192 0.11
193 0.13
194 0.16
195 0.19
196 0.23
197 0.28
198 0.33
199 0.35
200 0.41
201 0.49
202 0.51
203 0.51
204 0.51
205 0.55
206 0.57
207 0.59
208 0.6
209 0.54
210 0.51
211 0.48
212 0.44
213 0.38
214 0.33
215 0.27
216 0.23
217 0.26
218 0.26
219 0.25
220 0.3
221 0.33
222 0.34
223 0.35
224 0.33
225 0.27
226 0.28
227 0.28
228 0.25
229 0.23
230 0.23
231 0.2
232 0.19
233 0.2
234 0.19
235 0.2
236 0.17
237 0.18
238 0.18
239 0.18
240 0.22
241 0.23
242 0.23
243 0.22
244 0.23
245 0.21
246 0.23
247 0.28
248 0.23
249 0.23
250 0.22
251 0.22
252 0.2
253 0.2
254 0.16
255 0.12
256 0.11
257 0.11
258 0.16
259 0.16
260 0.17
261 0.15
262 0.13
263 0.12
264 0.13
265 0.12
266 0.07
267 0.06
268 0.09
269 0.12
270 0.13
271 0.13
272 0.14
273 0.14
274 0.15
275 0.16
276 0.16
277 0.13
278 0.18
279 0.18
280 0.18
281 0.19
282 0.19
283 0.18
284 0.16
285 0.18
286 0.16
287 0.16
288 0.16
289 0.15
290 0.15
291 0.17
292 0.19
293 0.16
294 0.15
295 0.15
296 0.15
297 0.2
298 0.22
299 0.24
300 0.23
301 0.24
302 0.26
303 0.25