Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165D1J2

Protein Details
Accession A0A165D1J2   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPHKRPKRAVRESKAKEQGVBasic
45-64ASARAQFKEKKRKREEGGEEBasic
NLS Segment(s)
PositionSequence
4-15KRPKRAVRESKA
48-88RAQFKEKKRKREEGGEEPAKRQEKAVKRRKTEEGKEKEELK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKRPKRAVRESKAKEQGVDNAPKAGAASADDAPKGALRVLNAASARAQFKEKKRKREEGGEEPAKRQEKAVKRRKTEEGKEKEELKLRPGESLADFNRRVDQALIPRIRSSKSSKSKAAAAADSATTSPAFPASNPSRKTDFDALPKPRRLNDVAQAPPSLTKLPRNAGKLGVGARTKAEGVVSMATKVALEEERERVVERYRMMKEARVQSKESEGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.79
3 0.7
4 0.62
5 0.6
6 0.57
7 0.57
8 0.47
9 0.4
10 0.38
11 0.35
12 0.32
13 0.24
14 0.16
15 0.1
16 0.13
17 0.12
18 0.14
19 0.14
20 0.14
21 0.14
22 0.14
23 0.13
24 0.11
25 0.1
26 0.09
27 0.13
28 0.14
29 0.17
30 0.17
31 0.17
32 0.17
33 0.19
34 0.2
35 0.18
36 0.22
37 0.25
38 0.35
39 0.46
40 0.52
41 0.6
42 0.68
43 0.76
44 0.77
45 0.8
46 0.79
47 0.77
48 0.8
49 0.78
50 0.71
51 0.63
52 0.64
53 0.55
54 0.47
55 0.4
56 0.38
57 0.39
58 0.48
59 0.56
60 0.58
61 0.62
62 0.68
63 0.75
64 0.76
65 0.75
66 0.75
67 0.73
68 0.7
69 0.69
70 0.65
71 0.59
72 0.56
73 0.47
74 0.4
75 0.37
76 0.32
77 0.28
78 0.26
79 0.24
80 0.19
81 0.23
82 0.22
83 0.22
84 0.22
85 0.21
86 0.23
87 0.21
88 0.21
89 0.17
90 0.17
91 0.16
92 0.24
93 0.25
94 0.23
95 0.24
96 0.25
97 0.24
98 0.25
99 0.26
100 0.29
101 0.36
102 0.41
103 0.43
104 0.44
105 0.47
106 0.47
107 0.43
108 0.33
109 0.25
110 0.21
111 0.18
112 0.16
113 0.13
114 0.09
115 0.07
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.13
122 0.19
123 0.27
124 0.29
125 0.33
126 0.35
127 0.36
128 0.42
129 0.4
130 0.38
131 0.38
132 0.45
133 0.5
134 0.55
135 0.59
136 0.55
137 0.51
138 0.52
139 0.48
140 0.44
141 0.42
142 0.43
143 0.41
144 0.41
145 0.39
146 0.35
147 0.32
148 0.29
149 0.25
150 0.18
151 0.2
152 0.23
153 0.29
154 0.34
155 0.37
156 0.37
157 0.36
158 0.36
159 0.34
160 0.31
161 0.31
162 0.26
163 0.23
164 0.22
165 0.21
166 0.2
167 0.17
168 0.15
169 0.1
170 0.11
171 0.13
172 0.13
173 0.12
174 0.12
175 0.12
176 0.11
177 0.1
178 0.11
179 0.09
180 0.12
181 0.15
182 0.18
183 0.2
184 0.21
185 0.23
186 0.23
187 0.27
188 0.28
189 0.29
190 0.34
191 0.35
192 0.4
193 0.4
194 0.44
195 0.47
196 0.53
197 0.58
198 0.54
199 0.54
200 0.51