Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165JAB1

Protein Details
Accession A0A165JAB1   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
219-238AHSPSKRKPGRPRRMTANPYHydrophilic
325-347GGAKTTPERRYPRRTKMSVDMGRHydrophilic
NLS Segment(s)
PositionSequence
223-232SKRKPGRPRR
370-380KRGRGRPRKNA
Subcellular Location(s) plas 13, mito 6, cyto 3, nucl 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPLSPKSASSQLPTAPATLRSELLRPYIYLPLLLSLLLLALSLWDQSRYTLSLLSPVLFLWSTVLLPLPAWAHLLWLAARGGWGWWDGYRELVRVTMYEAVAFLLLWPVLEDVRQAVRAVVPLLPRRAERKGLELRIVWGWALAQVARAAAWALGKVAGVSRVSGDAYRKALAGEGAAADRSGFLAARLDSIIRATTSLSLTSSTSASVPSPEDGAPAHSPSKRKPGRPRRMTANPYSLAPPPLHIPPSHPAHPAQPAQAHQSPPSLKVAAAAAAAARKYRLPASPPSSDRELPASGSASAVEQHGHGYGHGHGYPEGAEPGGGGAKTTPERRYPRRTKMSVDMGRTPEPVLRELREVKLEEEGVSPVKRGRGRPRKNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.3
4 0.3
5 0.3
6 0.27
7 0.27
8 0.24
9 0.27
10 0.27
11 0.29
12 0.26
13 0.23
14 0.24
15 0.27
16 0.25
17 0.23
18 0.21
19 0.18
20 0.17
21 0.16
22 0.13
23 0.07
24 0.07
25 0.06
26 0.05
27 0.03
28 0.03
29 0.04
30 0.05
31 0.06
32 0.07
33 0.07
34 0.09
35 0.11
36 0.12
37 0.13
38 0.14
39 0.14
40 0.18
41 0.19
42 0.18
43 0.16
44 0.14
45 0.16
46 0.13
47 0.13
48 0.09
49 0.09
50 0.08
51 0.08
52 0.09
53 0.07
54 0.07
55 0.09
56 0.08
57 0.08
58 0.1
59 0.09
60 0.1
61 0.1
62 0.11
63 0.09
64 0.11
65 0.1
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.08
72 0.07
73 0.08
74 0.1
75 0.1
76 0.14
77 0.15
78 0.15
79 0.15
80 0.15
81 0.14
82 0.12
83 0.14
84 0.14
85 0.13
86 0.12
87 0.12
88 0.1
89 0.1
90 0.09
91 0.07
92 0.05
93 0.05
94 0.04
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.08
102 0.09
103 0.09
104 0.09
105 0.09
106 0.1
107 0.11
108 0.12
109 0.15
110 0.18
111 0.2
112 0.22
113 0.23
114 0.27
115 0.3
116 0.33
117 0.3
118 0.35
119 0.41
120 0.42
121 0.43
122 0.39
123 0.37
124 0.32
125 0.31
126 0.22
127 0.14
128 0.11
129 0.08
130 0.08
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.07
152 0.08
153 0.1
154 0.11
155 0.12
156 0.13
157 0.12
158 0.12
159 0.12
160 0.1
161 0.09
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.03
172 0.03
173 0.05
174 0.05
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.07
181 0.05
182 0.05
183 0.05
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.08
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.07
199 0.09
200 0.08
201 0.09
202 0.08
203 0.11
204 0.11
205 0.13
206 0.16
207 0.17
208 0.2
209 0.22
210 0.33
211 0.36
212 0.43
213 0.53
214 0.61
215 0.69
216 0.76
217 0.78
218 0.77
219 0.81
220 0.79
221 0.74
222 0.7
223 0.59
224 0.52
225 0.48
226 0.4
227 0.32
228 0.26
229 0.21
230 0.16
231 0.17
232 0.17
233 0.15
234 0.17
235 0.22
236 0.28
237 0.29
238 0.29
239 0.28
240 0.29
241 0.35
242 0.33
243 0.3
244 0.27
245 0.26
246 0.31
247 0.34
248 0.32
249 0.28
250 0.32
251 0.3
252 0.28
253 0.3
254 0.24
255 0.2
256 0.19
257 0.19
258 0.14
259 0.12
260 0.11
261 0.08
262 0.09
263 0.09
264 0.08
265 0.09
266 0.08
267 0.1
268 0.13
269 0.16
270 0.19
271 0.27
272 0.33
273 0.4
274 0.42
275 0.45
276 0.47
277 0.45
278 0.42
279 0.37
280 0.32
281 0.26
282 0.25
283 0.22
284 0.16
285 0.16
286 0.14
287 0.11
288 0.11
289 0.1
290 0.08
291 0.07
292 0.08
293 0.09
294 0.09
295 0.08
296 0.1
297 0.1
298 0.14
299 0.14
300 0.15
301 0.14
302 0.14
303 0.15
304 0.14
305 0.14
306 0.1
307 0.09
308 0.07
309 0.08
310 0.1
311 0.08
312 0.07
313 0.07
314 0.11
315 0.16
316 0.21
317 0.25
318 0.32
319 0.41
320 0.5
321 0.61
322 0.67
323 0.73
324 0.79
325 0.8
326 0.78
327 0.78
328 0.8
329 0.76
330 0.72
331 0.69
332 0.63
333 0.61
334 0.55
335 0.47
336 0.39
337 0.34
338 0.32
339 0.29
340 0.26
341 0.31
342 0.34
343 0.37
344 0.4
345 0.39
346 0.37
347 0.37
348 0.35
349 0.3
350 0.26
351 0.25
352 0.24
353 0.23
354 0.23
355 0.21
356 0.27
357 0.32
358 0.39
359 0.48
360 0.55