Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165J8H8

Protein Details
Accession A0A165J8H8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-83AYYDSGSARRKKKRRARPGRAPFLLLHydrophilic
NLS Segment(s)
PositionSequence
65-77ARRKKKRRARPGR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MYPRDRSLPPPPELQEGPAQGGSPPPQNLRNQLSPLAPLPALRSPPGLAELPSEALIAYYDSGSARRKKKRRARPGRAPFLLLAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.34
4 0.34
5 0.27
6 0.24
7 0.18
8 0.2
9 0.19
10 0.18
11 0.19
12 0.19
13 0.23
14 0.26
15 0.32
16 0.35
17 0.36
18 0.34
19 0.34
20 0.32
21 0.29
22 0.27
23 0.22
24 0.16
25 0.13
26 0.13
27 0.13
28 0.14
29 0.13
30 0.13
31 0.11
32 0.12
33 0.14
34 0.12
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.08
50 0.14
51 0.22
52 0.31
53 0.41
54 0.5
55 0.61
56 0.71
57 0.8
58 0.86
59 0.9
60 0.91
61 0.92
62 0.94
63 0.94
64 0.87
65 0.79