Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165IYY2

Protein Details
Accession A0A165IYY2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
237-267LPDPERWLKKRDRTKDVRRAKKGKKEGMGAGBasic
NLS Segment(s)
PositionSequence
242-263RWLKKRDRTKDVRRAKKGKKEG
288-297AGKKKKKQGR
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026270  SRP72  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Amino Acid Sequences MPQTASKQRQPVANKPQKSLDERVALLFTSLAAQLEGAHFRNALRNCDRILKLLPDDRDAAETKLYLLLQLEQYEQALELISAFPLDLTFERAYCLYRLHSRDEAFILLEQLRVAGTQQRGCEHLEAQLRYRDTAYDECLKLYTHLLDTCPEDGDESDDILNNLGAAQSYIDFINSGYQGAIHELNLDVSKLEASPPTIATTSMTAPSVSNPGKPSPPRLARKSRIPNHVVLGVTPLPDPERWLKKRDRTKDVRRAKKGKKEGMGAGATQGVAVGAAPTPSATGGTGAGKKKKKQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.66
3 0.7
4 0.69
5 0.68
6 0.64
7 0.6
8 0.55
9 0.52
10 0.49
11 0.42
12 0.35
13 0.28
14 0.22
15 0.15
16 0.1
17 0.1
18 0.08
19 0.07
20 0.07
21 0.07
22 0.09
23 0.12
24 0.13
25 0.13
26 0.13
27 0.14
28 0.22
29 0.24
30 0.3
31 0.3
32 0.32
33 0.33
34 0.41
35 0.42
36 0.38
37 0.39
38 0.36
39 0.37
40 0.4
41 0.4
42 0.34
43 0.35
44 0.32
45 0.32
46 0.29
47 0.24
48 0.19
49 0.17
50 0.15
51 0.15
52 0.14
53 0.12
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.11
60 0.12
61 0.11
62 0.1
63 0.08
64 0.07
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.1
76 0.1
77 0.1
78 0.12
79 0.12
80 0.14
81 0.13
82 0.14
83 0.13
84 0.2
85 0.22
86 0.26
87 0.3
88 0.3
89 0.31
90 0.3
91 0.27
92 0.21
93 0.19
94 0.16
95 0.11
96 0.11
97 0.09
98 0.07
99 0.07
100 0.06
101 0.06
102 0.09
103 0.11
104 0.14
105 0.15
106 0.16
107 0.18
108 0.19
109 0.2
110 0.15
111 0.18
112 0.21
113 0.21
114 0.22
115 0.25
116 0.24
117 0.23
118 0.23
119 0.18
120 0.16
121 0.16
122 0.17
123 0.19
124 0.18
125 0.18
126 0.18
127 0.18
128 0.16
129 0.15
130 0.13
131 0.09
132 0.09
133 0.09
134 0.1
135 0.11
136 0.11
137 0.1
138 0.09
139 0.08
140 0.08
141 0.1
142 0.09
143 0.08
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.04
150 0.04
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.07
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.08
168 0.08
169 0.06
170 0.06
171 0.06
172 0.07
173 0.07
174 0.07
175 0.05
176 0.05
177 0.05
178 0.05
179 0.06
180 0.06
181 0.07
182 0.08
183 0.09
184 0.1
185 0.11
186 0.11
187 0.11
188 0.12
189 0.12
190 0.11
191 0.11
192 0.1
193 0.1
194 0.11
195 0.17
196 0.16
197 0.18
198 0.19
199 0.21
200 0.28
201 0.3
202 0.35
203 0.38
204 0.47
205 0.52
206 0.59
207 0.66
208 0.66
209 0.75
210 0.8
211 0.78
212 0.78
213 0.73
214 0.67
215 0.6
216 0.58
217 0.47
218 0.36
219 0.33
220 0.25
221 0.22
222 0.18
223 0.16
224 0.14
225 0.14
226 0.17
227 0.21
228 0.31
229 0.33
230 0.41
231 0.49
232 0.57
233 0.68
234 0.74
235 0.76
236 0.76
237 0.84
238 0.88
239 0.89
240 0.9
241 0.91
242 0.92
243 0.91
244 0.91
245 0.91
246 0.89
247 0.85
248 0.81
249 0.75
250 0.71
251 0.63
252 0.52
253 0.43
254 0.35
255 0.27
256 0.21
257 0.16
258 0.08
259 0.06
260 0.06
261 0.05
262 0.04
263 0.04
264 0.05
265 0.05
266 0.05
267 0.06
268 0.07
269 0.06
270 0.07
271 0.09
272 0.14
273 0.2
274 0.27
275 0.36
276 0.43
277 0.49