Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165EFX1

Protein Details
Accession A0A165EFX1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
148-171EEAEERRAKRRKTAPKKDKAEGATBasic
NLS Segment(s)
PositionSequence
146-195RREEAEERRAKRRKTAPKKDKAEGATKGKGKAASAGKGKGKGKGKAGKVE
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MSTQPTQPMRAPRMSDWVAKQCTTRGGNAYTQYEMKHLSGLYIRGQGWEALLNHTFVHLSPPADMGGIDDLSYWASDGHHIVWVKKSVDGGVQWVKTGPEDRDGDNPPRHSIEHELTLHFDSVRGYRWEVPPKSMAELMAEDEERRREEAEERRAKRRKTAPKKDKAEGATKGKGKAASAGKGKGKGKGKAGKVEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.49
4 0.51
5 0.49
6 0.46
7 0.45
8 0.39
9 0.43
10 0.4
11 0.37
12 0.32
13 0.32
14 0.35
15 0.38
16 0.38
17 0.33
18 0.32
19 0.29
20 0.27
21 0.25
22 0.21
23 0.19
24 0.16
25 0.15
26 0.16
27 0.18
28 0.18
29 0.2
30 0.2
31 0.18
32 0.19
33 0.17
34 0.15
35 0.17
36 0.15
37 0.14
38 0.15
39 0.15
40 0.14
41 0.14
42 0.14
43 0.1
44 0.13
45 0.11
46 0.11
47 0.11
48 0.12
49 0.12
50 0.11
51 0.11
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.04
62 0.04
63 0.05
64 0.06
65 0.06
66 0.1
67 0.11
68 0.11
69 0.14
70 0.17
71 0.17
72 0.17
73 0.17
74 0.13
75 0.14
76 0.13
77 0.15
78 0.16
79 0.15
80 0.14
81 0.14
82 0.14
83 0.13
84 0.15
85 0.12
86 0.13
87 0.14
88 0.15
89 0.2
90 0.23
91 0.29
92 0.3
93 0.31
94 0.28
95 0.28
96 0.27
97 0.24
98 0.25
99 0.21
100 0.23
101 0.23
102 0.22
103 0.22
104 0.22
105 0.21
106 0.16
107 0.14
108 0.09
109 0.09
110 0.12
111 0.12
112 0.13
113 0.17
114 0.23
115 0.32
116 0.32
117 0.34
118 0.35
119 0.34
120 0.34
121 0.31
122 0.25
123 0.18
124 0.17
125 0.16
126 0.14
127 0.13
128 0.11
129 0.13
130 0.15
131 0.14
132 0.15
133 0.14
134 0.14
135 0.21
136 0.3
137 0.39
138 0.47
139 0.5
140 0.6
141 0.67
142 0.67
143 0.69
144 0.71
145 0.71
146 0.73
147 0.8
148 0.8
149 0.83
150 0.89
151 0.85
152 0.82
153 0.76
154 0.73
155 0.7
156 0.66
157 0.64
158 0.6
159 0.56
160 0.52
161 0.48
162 0.41
163 0.4
164 0.38
165 0.38
166 0.4
167 0.45
168 0.46
169 0.53
170 0.54
171 0.54
172 0.57
173 0.55
174 0.59
175 0.61
176 0.62
177 0.64