Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165D2M7

Protein Details
Accession A0A165D2M7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
211-242SMERAQREALRRERRKRKSRWRDTMKSVKSVKBasic
NLS Segment(s)
PositionSequence
219-232ALRRERRKRKSRWR
Subcellular Location(s) mito 9plas 9, extr 6, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTSSSTAPWGLSRASFAGLLTAGIFFGLALVCLVVYAVWRWRRSAVRTSKAYLAQPYRVAEMPYTISPPRHSIMKPPAYFPSPWARDAEDQKVATAMLELKSPPLPGYSVPESMAHELRQSLAASAKTTTRTVATAGSPITPGLPSIVVTSPLSPHVRLPSIPPPLPIPTRDAERTALARYTMPPPTPTCHVTGMPLDLSMRTPPPVYNASMERAQREALRRERRKRKSRWRDTMKSVKSVKSVVSTSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.14
5 0.12
6 0.11
7 0.09
8 0.08
9 0.06
10 0.06
11 0.06
12 0.04
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.03
22 0.04
23 0.05
24 0.13
25 0.19
26 0.2
27 0.22
28 0.28
29 0.35
30 0.39
31 0.48
32 0.51
33 0.54
34 0.57
35 0.59
36 0.59
37 0.57
38 0.55
39 0.52
40 0.46
41 0.41
42 0.4
43 0.38
44 0.35
45 0.32
46 0.3
47 0.23
48 0.2
49 0.19
50 0.17
51 0.19
52 0.18
53 0.18
54 0.19
55 0.22
56 0.22
57 0.24
58 0.24
59 0.28
60 0.37
61 0.44
62 0.43
63 0.43
64 0.45
65 0.42
66 0.42
67 0.37
68 0.38
69 0.31
70 0.31
71 0.3
72 0.29
73 0.31
74 0.35
75 0.37
76 0.31
77 0.29
78 0.28
79 0.26
80 0.23
81 0.18
82 0.15
83 0.11
84 0.07
85 0.07
86 0.07
87 0.08
88 0.09
89 0.1
90 0.09
91 0.08
92 0.08
93 0.08
94 0.14
95 0.15
96 0.15
97 0.16
98 0.16
99 0.17
100 0.19
101 0.19
102 0.14
103 0.12
104 0.11
105 0.1
106 0.11
107 0.1
108 0.08
109 0.09
110 0.09
111 0.09
112 0.1
113 0.11
114 0.11
115 0.12
116 0.12
117 0.1
118 0.1
119 0.1
120 0.11
121 0.1
122 0.1
123 0.1
124 0.1
125 0.09
126 0.08
127 0.08
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.07
134 0.07
135 0.09
136 0.09
137 0.09
138 0.09
139 0.13
140 0.14
141 0.13
142 0.14
143 0.15
144 0.16
145 0.17
146 0.21
147 0.25
148 0.3
149 0.3
150 0.29
151 0.29
152 0.32
153 0.33
154 0.3
155 0.26
156 0.21
157 0.26
158 0.26
159 0.26
160 0.24
161 0.25
162 0.25
163 0.23
164 0.22
165 0.18
166 0.17
167 0.18
168 0.2
169 0.21
170 0.21
171 0.22
172 0.23
173 0.26
174 0.29
175 0.29
176 0.28
177 0.27
178 0.26
179 0.26
180 0.25
181 0.23
182 0.19
183 0.18
184 0.15
185 0.13
186 0.13
187 0.13
188 0.13
189 0.12
190 0.13
191 0.13
192 0.17
193 0.2
194 0.21
195 0.23
196 0.24
197 0.26
198 0.31
199 0.32
200 0.3
201 0.28
202 0.28
203 0.29
204 0.33
205 0.38
206 0.43
207 0.52
208 0.6
209 0.7
210 0.79
211 0.85
212 0.89
213 0.92
214 0.93
215 0.93
216 0.95
217 0.95
218 0.95
219 0.93
220 0.93
221 0.93
222 0.87
223 0.85
224 0.79
225 0.73
226 0.66
227 0.59
228 0.52
229 0.47
230 0.42