Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DVY2

Protein Details
Accession A0A165DVY2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-85QDRADKRKMLREKARENAKQBasic
NLS Segment(s)
PositionSequence
43-80KRKVAKHQEKVDRAKEREKLQRLQDRADKRKMLREKAR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences SNSSILTHSRSVWEAKKRARREQVQEVVFDEDARRDFLTGFHKRKVAKHQEKVDRAKEREKLQRLQDRADKRKMLREKARENAKQVEAALG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.6
4 0.64
5 0.72
6 0.76
7 0.78
8 0.77
9 0.79
10 0.78
11 0.7
12 0.64
13 0.56
14 0.49
15 0.4
16 0.32
17 0.21
18 0.14
19 0.13
20 0.14
21 0.12
22 0.09
23 0.09
24 0.12
25 0.21
26 0.28
27 0.3
28 0.31
29 0.35
30 0.36
31 0.41
32 0.48
33 0.5
34 0.51
35 0.56
36 0.63
37 0.68
38 0.74
39 0.77
40 0.75
41 0.72
42 0.66
43 0.65
44 0.61
45 0.6
46 0.61
47 0.61
48 0.59
49 0.6
50 0.64
51 0.61
52 0.62
53 0.62
54 0.63
55 0.65
56 0.66
57 0.64
58 0.58
59 0.65
60 0.67
61 0.7
62 0.7
63 0.72
64 0.73
65 0.76
66 0.83
67 0.79
68 0.76
69 0.73
70 0.66
71 0.58