Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165F278

Protein Details
Accession A0A165F278    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-73GQPSGPFRKAKRKRASVRKKNRRREAAQADAHydrophilic
NLS Segment(s)
PositionSequence
49-67FRKAKRKRASVRKKNRRRE
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, pero 7
Family & Domain DBs
Amino Acid Sequences MTIDDTEVVPHTTDELQATTGEKDKDAEHDAAASAFKSDDEEGQPSGPFRKAKRKRASVRKKNRRREAAQADAASPSNTSHTPFTRVRVRILKDPRRSLWGILGQPIVLLHWTNLNAKDLALPQYTAAMGQAGWHDIEPVEISEDKFVREFVLKVGWVKYNGEKFDWLIGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.13
5 0.14
6 0.14
7 0.18
8 0.18
9 0.17
10 0.17
11 0.17
12 0.21
13 0.23
14 0.22
15 0.18
16 0.18
17 0.18
18 0.17
19 0.16
20 0.12
21 0.08
22 0.07
23 0.07
24 0.08
25 0.09
26 0.1
27 0.12
28 0.14
29 0.15
30 0.15
31 0.16
32 0.15
33 0.17
34 0.19
35 0.21
36 0.24
37 0.35
38 0.44
39 0.54
40 0.63
41 0.71
42 0.77
43 0.84
44 0.91
45 0.91
46 0.93
47 0.93
48 0.94
49 0.94
50 0.93
51 0.91
52 0.84
53 0.84
54 0.81
55 0.77
56 0.71
57 0.61
58 0.51
59 0.43
60 0.38
61 0.28
62 0.19
63 0.12
64 0.09
65 0.09
66 0.1
67 0.11
68 0.12
69 0.17
70 0.18
71 0.22
72 0.28
73 0.29
74 0.32
75 0.36
76 0.38
77 0.41
78 0.5
79 0.55
80 0.54
81 0.58
82 0.55
83 0.54
84 0.52
85 0.44
86 0.39
87 0.35
88 0.29
89 0.26
90 0.25
91 0.19
92 0.18
93 0.17
94 0.12
95 0.07
96 0.06
97 0.04
98 0.06
99 0.08
100 0.1
101 0.12
102 0.13
103 0.13
104 0.13
105 0.14
106 0.14
107 0.16
108 0.15
109 0.14
110 0.12
111 0.13
112 0.13
113 0.11
114 0.09
115 0.06
116 0.05
117 0.06
118 0.06
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.08
125 0.07
126 0.07
127 0.09
128 0.1
129 0.11
130 0.15
131 0.15
132 0.16
133 0.16
134 0.15
135 0.15
136 0.16
137 0.16
138 0.14
139 0.18
140 0.18
141 0.21
142 0.24
143 0.25
144 0.25
145 0.28
146 0.34
147 0.36
148 0.37
149 0.37
150 0.36
151 0.34