Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165JJR5

Protein Details
Accession A0A165JJR5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-33APPKEQRSPSRAERRRRRCASTPPSPLDHydrophilic
NLS Segment(s)
PositionSequence
16-22RAERRRR
Subcellular Location(s) nucl 9, mito 7, plas 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024512  Ser_palmitoyltrfase_ssu-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF11779  SPT_ssu-like  
Amino Acid Sequences MPLLLAPPKEQRSPSRAERRRRRCASTPPSPLDLASSRHTSLRHLVDEAKDWDPRVLVPPSPTDSTSSYRARPLRRPFHDPYASRWARMRLLLEVNFALSMMQDWEKGLFVAITLLVLVLMAGALYGLPASVLFIASRLRYYASGAQTLGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.65
4 0.72
5 0.78
6 0.81
7 0.87
8 0.87
9 0.85
10 0.82
11 0.85
12 0.83
13 0.82
14 0.81
15 0.74
16 0.7
17 0.62
18 0.53
19 0.46
20 0.39
21 0.33
22 0.27
23 0.26
24 0.24
25 0.26
26 0.26
27 0.24
28 0.28
29 0.29
30 0.26
31 0.25
32 0.26
33 0.25
34 0.29
35 0.3
36 0.26
37 0.23
38 0.22
39 0.2
40 0.18
41 0.17
42 0.18
43 0.16
44 0.15
45 0.15
46 0.17
47 0.2
48 0.21
49 0.21
50 0.19
51 0.21
52 0.23
53 0.27
54 0.27
55 0.24
56 0.29
57 0.33
58 0.35
59 0.41
60 0.47
61 0.52
62 0.53
63 0.6
64 0.58
65 0.61
66 0.64
67 0.57
68 0.53
69 0.54
70 0.5
71 0.44
72 0.42
73 0.36
74 0.3
75 0.31
76 0.26
77 0.18
78 0.22
79 0.22
80 0.21
81 0.18
82 0.17
83 0.15
84 0.13
85 0.1
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.05
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.04
119 0.04
120 0.04
121 0.06
122 0.09
123 0.1
124 0.11
125 0.11
126 0.13
127 0.13
128 0.18
129 0.24
130 0.25
131 0.27