Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165D9M5

Protein Details
Accession A0A165D9M5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
40-64QGSHMKPPRHQTRRTHTQKHPSAERBasic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSGRSCGSVNLLASGVSSASLPEFGPAELFASDDLARHVQGSHMKPPRHQTRRTHTQKHPSAERAGQRELFWEFPQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.07
4 0.06
5 0.05
6 0.05
7 0.06
8 0.05
9 0.06
10 0.06
11 0.06
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.08
27 0.14
28 0.17
29 0.24
30 0.3
31 0.31
32 0.34
33 0.44
34 0.53
35 0.55
36 0.6
37 0.6
38 0.63
39 0.73
40 0.8
41 0.8
42 0.78
43 0.81
44 0.81
45 0.8
46 0.77
47 0.7
48 0.66
49 0.64
50 0.63
51 0.57
52 0.54
53 0.48
54 0.42
55 0.41
56 0.38
57 0.35
58 0.29