Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WRK2

Protein Details
Accession G2WRK2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-38KSSSRPAPTGKPKQTTKKQSKVNKPQKAKANSHydrophilic
NLS Segment(s)
PositionSequence
14-36PTGKPKQTTKKQSKVNKPQKAKA
71-89KGKKADKSEKGLNKGGSRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG vda:VDAG_00185  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGAIKSSSRPAPTGKPKQTTKKQSKVNKPQKAKANSAADKLQKKYCAGLITKTEKMLGERAGHLELIGKGKKADKSEKGLNKGGSRRYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.6
4 0.63
5 0.69
6 0.77
7 0.83
8 0.84
9 0.84
10 0.82
11 0.84
12 0.85
13 0.88
14 0.89
15 0.89
16 0.88
17 0.85
18 0.83
19 0.83
20 0.79
21 0.73
22 0.7
23 0.68
24 0.6
25 0.56
26 0.53
27 0.49
28 0.48
29 0.46
30 0.4
31 0.33
32 0.31
33 0.29
34 0.27
35 0.25
36 0.21
37 0.22
38 0.25
39 0.29
40 0.29
41 0.28
42 0.26
43 0.23
44 0.23
45 0.22
46 0.19
47 0.16
48 0.16
49 0.18
50 0.17
51 0.17
52 0.15
53 0.15
54 0.14
55 0.18
56 0.18
57 0.17
58 0.18
59 0.22
60 0.27
61 0.31
62 0.38
63 0.39
64 0.46
65 0.55
66 0.62
67 0.64
68 0.66
69 0.66
70 0.64
71 0.65