Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165D6M5

Protein Details
Accession A0A165D6M5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
151-173EELNKTKPFRTRKPLASRSHSRAHydrophilic
NLS Segment(s)
PositionSequence
155-194KTKPFRTRKPLASRSHSRAAREQRAGGRILDRAAGRGNGR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001404  Hsp90_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0140662  F:ATP-dependent protein folding chaperone  
GO:0051082  F:unfolded protein binding  
Pfam View protein in Pfam  
PF00183  HSP90  
Amino Acid Sequences MTPITLARRPGEYDPQATRENSAASKTGLRARVAAAQEGEDEGKIEEVDDEDKKKTTTVKEKVVENERLNNKTKHLAPANRSRDNAGRVGLAGRGEREWSDSQPAARRHQGGRDGVKDDEEAKEDKAKIEEVDDEDKKKTKSVKEKVVENEELNKTKPFRTRKPLASRSHSRAAREQRAGGRILDRAAGRGNGRAGQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.47
4 0.44
5 0.41
6 0.33
7 0.32
8 0.27
9 0.25
10 0.22
11 0.2
12 0.23
13 0.24
14 0.28
15 0.29
16 0.28
17 0.27
18 0.27
19 0.32
20 0.3
21 0.29
22 0.24
23 0.2
24 0.2
25 0.2
26 0.18
27 0.11
28 0.11
29 0.08
30 0.08
31 0.07
32 0.07
33 0.06
34 0.06
35 0.1
36 0.12
37 0.14
38 0.15
39 0.16
40 0.17
41 0.18
42 0.22
43 0.27
44 0.35
45 0.39
46 0.47
47 0.49
48 0.53
49 0.58
50 0.6
51 0.59
52 0.51
53 0.52
54 0.49
55 0.49
56 0.5
57 0.45
58 0.4
59 0.38
60 0.38
61 0.37
62 0.39
63 0.4
64 0.42
65 0.51
66 0.57
67 0.55
68 0.54
69 0.49
70 0.46
71 0.42
72 0.38
73 0.28
74 0.21
75 0.17
76 0.17
77 0.15
78 0.12
79 0.09
80 0.08
81 0.08
82 0.08
83 0.08
84 0.11
85 0.11
86 0.11
87 0.14
88 0.14
89 0.16
90 0.22
91 0.25
92 0.25
93 0.27
94 0.3
95 0.28
96 0.32
97 0.35
98 0.34
99 0.35
100 0.34
101 0.33
102 0.3
103 0.3
104 0.26
105 0.22
106 0.18
107 0.15
108 0.13
109 0.12
110 0.16
111 0.16
112 0.16
113 0.16
114 0.16
115 0.15
116 0.15
117 0.16
118 0.15
119 0.22
120 0.23
121 0.24
122 0.25
123 0.29
124 0.28
125 0.3
126 0.33
127 0.35
128 0.43
129 0.5
130 0.58
131 0.6
132 0.66
133 0.69
134 0.7
135 0.65
136 0.55
137 0.54
138 0.49
139 0.46
140 0.4
141 0.38
142 0.33
143 0.35
144 0.42
145 0.43
146 0.47
147 0.55
148 0.62
149 0.68
150 0.77
151 0.81
152 0.81
153 0.82
154 0.81
155 0.79
156 0.79
157 0.73
158 0.66
159 0.66
160 0.68
161 0.68
162 0.63
163 0.62
164 0.58
165 0.58
166 0.56
167 0.49
168 0.42
169 0.34
170 0.3
171 0.29
172 0.23
173 0.22
174 0.23
175 0.24
176 0.23
177 0.25
178 0.27