Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165FL10

Protein Details
Accession A0A165FL10    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-35QLHHPNSKKMTKRTKKVGVTGKYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002674  Ribosomal_L37ae  
IPR011331  Ribosomal_L37ae/L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01780  Ribosomal_L37ae  
Amino Acid Sequences MGVAAHLIATDVQLHHPNSKKMTKRTKKVGVTGKYGTRYGASLRKQVKKMEIQQHARYTCTFCGKDSVKRSAVGIWKCRACKKVVAGGAWTVSTTAAATVRSTVRRLRELAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.3
4 0.34
5 0.39
6 0.47
7 0.52
8 0.57
9 0.67
10 0.7
11 0.74
12 0.8
13 0.83
14 0.8
15 0.81
16 0.81
17 0.74
18 0.7
19 0.65
20 0.6
21 0.53
22 0.47
23 0.39
24 0.3
25 0.25
26 0.23
27 0.26
28 0.23
29 0.28
30 0.36
31 0.42
32 0.44
33 0.46
34 0.48
35 0.48
36 0.54
37 0.56
38 0.57
39 0.57
40 0.59
41 0.62
42 0.57
43 0.5
44 0.43
45 0.36
46 0.29
47 0.29
48 0.24
49 0.18
50 0.25
51 0.26
52 0.32
53 0.35
54 0.38
55 0.34
56 0.34
57 0.34
58 0.32
59 0.37
60 0.35
61 0.36
62 0.35
63 0.38
64 0.41
65 0.46
66 0.43
67 0.39
68 0.4
69 0.39
70 0.42
71 0.41
72 0.39
73 0.36
74 0.35
75 0.33
76 0.27
77 0.22
78 0.14
79 0.1
80 0.09
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.11
87 0.15
88 0.18
89 0.21
90 0.25
91 0.3
92 0.34
93 0.37