Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ED14

Protein Details
Accession A0A165ED14    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-36LWKIPWRLSTPRKARQRFRLKQVDNHydrophilic
73-93SPKSKGYRKGIHKVPKWTRITHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFPTLPTLSGLLWKIPWRLSTPRKARQRFRLKQVDNVIETIRQSGVECKALDDALALPKQHEMPAKDKYTVFSPKSKGYRKGIHKVPKWTRITQRVNPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.24
4 0.25
5 0.34
6 0.4
7 0.48
8 0.54
9 0.61
10 0.7
11 0.77
12 0.8
13 0.82
14 0.85
15 0.83
16 0.83
17 0.85
18 0.77
19 0.76
20 0.74
21 0.69
22 0.58
23 0.52
24 0.42
25 0.32
26 0.3
27 0.23
28 0.15
29 0.1
30 0.09
31 0.1
32 0.12
33 0.14
34 0.14
35 0.13
36 0.13
37 0.13
38 0.12
39 0.1
40 0.09
41 0.08
42 0.09
43 0.09
44 0.09
45 0.1
46 0.11
47 0.13
48 0.16
49 0.16
50 0.2
51 0.27
52 0.29
53 0.31
54 0.3
55 0.3
56 0.32
57 0.37
58 0.35
59 0.34
60 0.36
61 0.41
62 0.5
63 0.56
64 0.57
65 0.58
66 0.64
67 0.67
68 0.72
69 0.74
70 0.76
71 0.75
72 0.79
73 0.8
74 0.8
75 0.78
76 0.77
77 0.77
78 0.78
79 0.8
80 0.77
81 0.8