Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165H0A7

Protein Details
Accession A0A165H0A7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MHPSYGPPHRPPRRSRLTPCDSRLHydrophilic
NLS Segment(s)
PositionSequence
74-74R
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MHPSYGPPHRPPRRSRLTPCDSRLPFPVHRIPDPQPNPHNLHEAPGVLPPSRRAYHPPIRQSANRRLAPPAPSRPPAARP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.81
4 0.8
5 0.8
6 0.78
7 0.78
8 0.69
9 0.62
10 0.58
11 0.53
12 0.46
13 0.43
14 0.45
15 0.38
16 0.38
17 0.4
18 0.39
19 0.43
20 0.45
21 0.46
22 0.42
23 0.43
24 0.46
25 0.42
26 0.44
27 0.34
28 0.32
29 0.26
30 0.23
31 0.19
32 0.16
33 0.16
34 0.12
35 0.13
36 0.13
37 0.18
38 0.18
39 0.2
40 0.23
41 0.31
42 0.4
43 0.48
44 0.52
45 0.53
46 0.58
47 0.63
48 0.65
49 0.67
50 0.67
51 0.62
52 0.57
53 0.56
54 0.55
55 0.55
56 0.56
57 0.55
58 0.53
59 0.52
60 0.55