Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165KDN6

Protein Details
Accession A0A165KDN6   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-124EEWEEKQRRKKEKEEKDKKDKEVDKKDEKDKRKDKKESAPKSPPLBasic
143-167RSLFASRQLEHRKRRQLKEAREIAPHydrophilic
NLS Segment(s)
PositionSequence
85-121KQRRKKEKEEKDKKDKEVDKKDEKDKRKDKKESAPKS
155-157KRR
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFQNLYYQRVVATPRPCAVCLRPTTIVLSTMGNVDFIYTCERHLTDPGFASKLPDAGASPVPTTPKPPVDEELVKKVAEEWEEKQRRKKEKEEKDKKDKEVDKKDEKDKRKDKKESAPKSPPLPVTPSAPATPTHNRYVLHRSLFASRQLEHRKRRQLKEAREIAPRLPGVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.37
4 0.37
5 0.39
6 0.39
7 0.39
8 0.39
9 0.4
10 0.38
11 0.37
12 0.38
13 0.35
14 0.32
15 0.25
16 0.22
17 0.16
18 0.15
19 0.14
20 0.11
21 0.1
22 0.09
23 0.08
24 0.08
25 0.12
26 0.11
27 0.11
28 0.13
29 0.14
30 0.15
31 0.18
32 0.19
33 0.17
34 0.19
35 0.21
36 0.2
37 0.19
38 0.2
39 0.17
40 0.16
41 0.14
42 0.12
43 0.1
44 0.11
45 0.13
46 0.12
47 0.12
48 0.12
49 0.14
50 0.14
51 0.17
52 0.18
53 0.2
54 0.21
55 0.23
56 0.24
57 0.27
58 0.32
59 0.31
60 0.34
61 0.31
62 0.29
63 0.26
64 0.25
65 0.21
66 0.18
67 0.17
68 0.14
69 0.24
70 0.31
71 0.34
72 0.41
73 0.47
74 0.55
75 0.58
76 0.66
77 0.66
78 0.69
79 0.79
80 0.82
81 0.84
82 0.86
83 0.87
84 0.81
85 0.79
86 0.76
87 0.74
88 0.74
89 0.72
90 0.71
91 0.7
92 0.76
93 0.75
94 0.76
95 0.77
96 0.76
97 0.78
98 0.79
99 0.82
100 0.8
101 0.82
102 0.85
103 0.83
104 0.83
105 0.82
106 0.76
107 0.71
108 0.69
109 0.6
110 0.52
111 0.48
112 0.4
113 0.35
114 0.33
115 0.32
116 0.27
117 0.26
118 0.24
119 0.25
120 0.32
121 0.32
122 0.33
123 0.34
124 0.34
125 0.37
126 0.44
127 0.44
128 0.39
129 0.37
130 0.35
131 0.38
132 0.4
133 0.41
134 0.37
135 0.32
136 0.38
137 0.47
138 0.54
139 0.58
140 0.65
141 0.7
142 0.77
143 0.84
144 0.85
145 0.84
146 0.85
147 0.86
148 0.86
149 0.8
150 0.78
151 0.72
152 0.63
153 0.6