Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CSG2

Protein Details
Accession A0A165CSG2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-45SSDSACRLPKPKPKPKPKPKPKPKPGPRGEAQBasic
NLS Segment(s)
PositionSequence
22-47PKPKPKPKPKPKPKPKPGPRGEAQGR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MFRRAAAWPPFPVSSDSACRLPKPKPKPKPKPKPKPKPGPRGEAQGRPVMAPRSGSRSACVVREGGGSIDDGMRSVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.29
4 0.3
5 0.3
6 0.31
7 0.33
8 0.38
9 0.44
10 0.5
11 0.57
12 0.62
13 0.73
14 0.81
15 0.89
16 0.92
17 0.94
18 0.95
19 0.95
20 0.96
21 0.95
22 0.95
23 0.94
24 0.94
25 0.88
26 0.84
27 0.75
28 0.73
29 0.67
30 0.61
31 0.53
32 0.45
33 0.4
34 0.33
35 0.33
36 0.25
37 0.21
38 0.19
39 0.18
40 0.21
41 0.25
42 0.25
43 0.24
44 0.27
45 0.28
46 0.27
47 0.27
48 0.2
49 0.18
50 0.19
51 0.18
52 0.13
53 0.12
54 0.11
55 0.1
56 0.11
57 0.1