Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166JES1

Protein Details
Accession A0A166JES1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-90RSPSARQYRSPPPRRRSRSPDRGVQPHydrophilic
NLS Segment(s)
PositionSequence
25-83SRSPPHEPHRAPPTGERQYRSRTPPRYRRSPSPPPAHYRPRSPSARQYRSPPPRRRSRS
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MYKSRRGRSPLAHPPAVPYNARYRSRSPPHEPHRAPPTGERQYRSRTPPRYRRSPSPPPAHYRPRSPSARQYRSPPPRRRSRSPDRGVQPQTRSCYDAYEHRGRMDRSAIPCHRTRPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.53
4 0.44
5 0.36
6 0.37
7 0.43
8 0.47
9 0.46
10 0.45
11 0.52
12 0.6
13 0.65
14 0.64
15 0.66
16 0.7
17 0.76
18 0.73
19 0.71
20 0.69
21 0.63
22 0.56
23 0.52
24 0.54
25 0.52
26 0.54
27 0.49
28 0.46
29 0.5
30 0.54
31 0.56
32 0.55
33 0.56
34 0.62
35 0.69
36 0.73
37 0.76
38 0.76
39 0.77
40 0.77
41 0.78
42 0.76
43 0.75
44 0.72
45 0.68
46 0.7
47 0.7
48 0.64
49 0.6
50 0.56
51 0.55
52 0.56
53 0.53
54 0.56
55 0.57
56 0.61
57 0.58
58 0.59
59 0.62
60 0.67
61 0.74
62 0.74
63 0.72
64 0.76
65 0.81
66 0.84
67 0.83
68 0.83
69 0.84
70 0.8
71 0.81
72 0.75
73 0.77
74 0.75
75 0.72
76 0.68
77 0.63
78 0.62
79 0.55
80 0.51
81 0.41
82 0.38
83 0.33
84 0.35
85 0.37
86 0.4
87 0.4
88 0.42
89 0.48
90 0.46
91 0.47
92 0.44
93 0.42
94 0.38
95 0.47
96 0.48
97 0.48
98 0.51