Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165GWG5

Protein Details
Accession A0A165GWG5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-73NPYSQHRPNKRESPKKRPRSDDDPTSHydrophilic
NLS Segment(s)
PositionSequence
55-66PNKRESPKKRPR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKLSVEKLSLAIAASSECLDRLRRSNEHSPVSASQTTSREPPVSPGENPYSQHRPNKRESPKKRPRSDDDPTSIEVSPPRRRRGPVDEAVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.09
6 0.11
7 0.14
8 0.21
9 0.26
10 0.29
11 0.36
12 0.45
13 0.5
14 0.51
15 0.49
16 0.46
17 0.42
18 0.43
19 0.37
20 0.29
21 0.26
22 0.24
23 0.24
24 0.22
25 0.22
26 0.18
27 0.17
28 0.2
29 0.21
30 0.22
31 0.21
32 0.23
33 0.24
34 0.25
35 0.26
36 0.28
37 0.3
38 0.32
39 0.4
40 0.44
41 0.45
42 0.51
43 0.6
44 0.65
45 0.69
46 0.74
47 0.78
48 0.81
49 0.87
50 0.88
51 0.86
52 0.84
53 0.82
54 0.81
55 0.78
56 0.73
57 0.66
58 0.59
59 0.54
60 0.46
61 0.38
62 0.34
63 0.33
64 0.37
65 0.42
66 0.47
67 0.5
68 0.54
69 0.6
70 0.65
71 0.66