Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X9B8

Protein Details
Accession G2X9B8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24MVGSPRWRRRFRIRDPGETRKLQHydrophilic
87-106EPPKPPGQVRPGRRNDKVECBasic
NLS Segment(s)
PositionSequence
10-11RR
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG vda:VDAG_06750  -  
Amino Acid Sequences MMVGSPRWRRRFRIRDPGETRKLQGTTARRTGRRPIDQTTYLTSLTGYKDEVEVESERGSRVARGARRVAMDTTGCEMRARQSDEGEPPKPPGQVRPGRRNDKVECGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.84
4 0.86
5 0.82
6 0.75
7 0.67
8 0.61
9 0.55
10 0.46
11 0.44
12 0.42
13 0.41
14 0.48
15 0.52
16 0.49
17 0.52
18 0.59
19 0.6
20 0.61
21 0.58
22 0.54
23 0.54
24 0.54
25 0.53
26 0.48
27 0.4
28 0.32
29 0.27
30 0.22
31 0.17
32 0.15
33 0.14
34 0.1
35 0.08
36 0.08
37 0.08
38 0.08
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.07
48 0.09
49 0.14
50 0.16
51 0.21
52 0.23
53 0.25
54 0.26
55 0.28
56 0.26
57 0.23
58 0.21
59 0.17
60 0.18
61 0.17
62 0.15
63 0.14
64 0.14
65 0.15
66 0.21
67 0.24
68 0.22
69 0.24
70 0.27
71 0.35
72 0.41
73 0.39
74 0.34
75 0.35
76 0.37
77 0.37
78 0.35
79 0.34
80 0.38
81 0.45
82 0.54
83 0.6
84 0.67
85 0.73
86 0.79
87 0.8
88 0.75