Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X7U4

Protein Details
Accession G2X7U4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
520-541DELFERKIKHWRFHKTQTATQTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR020846  MFS_dom  
IPR005828  MFS_sugar_transport-like  
IPR036259  MFS_trans_sf  
IPR005829  Sugar_transporter_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
GO:0008643  P:carbohydrate transport  
KEGG vda:VDAG_06552  -  
Pfam View protein in Pfam  
PF00083  Sugar_tr  
PROSITE View protein in PROSITE  
PS50850  MFS  
PS00217  SUGAR_TRANSPORT_2  
Amino Acid Sequences MATEKATATGLEGHPSDNIAVGRREVAEQGKLDAKEASMEAAAKGQAISGFETLGLWETVKAFKVCTATCFLVAFSAATDGYQIGMNGNIIANPGFVRQFATETNDAGEPFLASPILSAWGSIMSVGQIIGMTSLPFLSDHFGRKAAMYGFWFVLAMSVLAESLARSWPVWLVAKLLAGIGVGCLQSTIPTYIAETAPVRIRGGLLMSYNFWFVLGNFFAPVALQVHSKVDADDWLTPVYTQWAQIGLMLIIFLFVPETPAWCVTRGYESRAKASLRRLHWEIKDYDLDYQYQLLVMAVDHEMEVARASQNEKWWSIFRGTDGRRTLTALWTLMTQQFIGLTLFSSFASYFFQQAGVEDPFQATCITSGINIAANFIFILTADKFGRRNISCGGSTLCWAACTAIGILGVVPRVKATEYLLVLFACLWNIGMTANGATGWGFIGEISSQRLRPYTAGFGAASTCVAGVVMNVLTPYMVNDNEWGWELKTGWFYVGLGAPFVVIMWFLIPETKGRSAAELDELFERKIKHWRFHKTQTATQTALLSRQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.19
4 0.16
5 0.17
6 0.16
7 0.17
8 0.18
9 0.19
10 0.2
11 0.21
12 0.21
13 0.24
14 0.25
15 0.24
16 0.27
17 0.31
18 0.3
19 0.3
20 0.27
21 0.24
22 0.21
23 0.2
24 0.18
25 0.13
26 0.14
27 0.13
28 0.14
29 0.14
30 0.12
31 0.11
32 0.11
33 0.1
34 0.11
35 0.13
36 0.11
37 0.11
38 0.1
39 0.11
40 0.1
41 0.1
42 0.1
43 0.08
44 0.08
45 0.1
46 0.12
47 0.15
48 0.15
49 0.14
50 0.17
51 0.22
52 0.21
53 0.23
54 0.27
55 0.25
56 0.26
57 0.26
58 0.22
59 0.18
60 0.18
61 0.15
62 0.1
63 0.09
64 0.08
65 0.07
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.09
82 0.09
83 0.09
84 0.11
85 0.11
86 0.13
87 0.14
88 0.2
89 0.19
90 0.19
91 0.21
92 0.2
93 0.19
94 0.17
95 0.16
96 0.1
97 0.09
98 0.09
99 0.07
100 0.06
101 0.06
102 0.06
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.06
111 0.04
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.08
126 0.1
127 0.14
128 0.16
129 0.17
130 0.17
131 0.17
132 0.2
133 0.18
134 0.18
135 0.16
136 0.17
137 0.16
138 0.15
139 0.15
140 0.11
141 0.11
142 0.08
143 0.07
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.03
150 0.04
151 0.05
152 0.06
153 0.06
154 0.06
155 0.07
156 0.1
157 0.12
158 0.12
159 0.13
160 0.13
161 0.13
162 0.13
163 0.12
164 0.09
165 0.07
166 0.06
167 0.04
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.06
175 0.07
176 0.06
177 0.07
178 0.08
179 0.1
180 0.1
181 0.11
182 0.1
183 0.12
184 0.14
185 0.15
186 0.14
187 0.12
188 0.12
189 0.11
190 0.11
191 0.1
192 0.09
193 0.09
194 0.09
195 0.1
196 0.1
197 0.09
198 0.08
199 0.07
200 0.06
201 0.09
202 0.08
203 0.08
204 0.08
205 0.08
206 0.07
207 0.07
208 0.08
209 0.06
210 0.06
211 0.06
212 0.07
213 0.08
214 0.09
215 0.09
216 0.09
217 0.08
218 0.08
219 0.09
220 0.1
221 0.1
222 0.09
223 0.09
224 0.09
225 0.08
226 0.1
227 0.09
228 0.08
229 0.08
230 0.08
231 0.08
232 0.09
233 0.09
234 0.06
235 0.05
236 0.05
237 0.04
238 0.04
239 0.03
240 0.03
241 0.02
242 0.02
243 0.04
244 0.04
245 0.06
246 0.06
247 0.08
248 0.09
249 0.09
250 0.1
251 0.09
252 0.15
253 0.15
254 0.2
255 0.24
256 0.24
257 0.25
258 0.29
259 0.29
260 0.26
261 0.33
262 0.35
263 0.32
264 0.36
265 0.37
266 0.4
267 0.4
268 0.42
269 0.35
270 0.31
271 0.31
272 0.26
273 0.25
274 0.2
275 0.19
276 0.15
277 0.14
278 0.11
279 0.09
280 0.08
281 0.05
282 0.05
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.04
292 0.04
293 0.04
294 0.05
295 0.07
296 0.09
297 0.13
298 0.16
299 0.17
300 0.18
301 0.19
302 0.2
303 0.21
304 0.2
305 0.18
306 0.24
307 0.25
308 0.3
309 0.31
310 0.3
311 0.29
312 0.3
313 0.29
314 0.22
315 0.22
316 0.16
317 0.14
318 0.12
319 0.13
320 0.12
321 0.12
322 0.09
323 0.07
324 0.07
325 0.07
326 0.07
327 0.06
328 0.05
329 0.05
330 0.06
331 0.06
332 0.07
333 0.06
334 0.06
335 0.09
336 0.09
337 0.1
338 0.09
339 0.1
340 0.09
341 0.09
342 0.13
343 0.11
344 0.11
345 0.11
346 0.11
347 0.1
348 0.11
349 0.11
350 0.07
351 0.06
352 0.06
353 0.06
354 0.05
355 0.06
356 0.06
357 0.08
358 0.08
359 0.09
360 0.08
361 0.08
362 0.08
363 0.07
364 0.06
365 0.04
366 0.07
367 0.06
368 0.1
369 0.1
370 0.13
371 0.14
372 0.16
373 0.24
374 0.22
375 0.25
376 0.25
377 0.29
378 0.27
379 0.28
380 0.29
381 0.21
382 0.21
383 0.2
384 0.16
385 0.12
386 0.12
387 0.1
388 0.08
389 0.08
390 0.07
391 0.06
392 0.06
393 0.06
394 0.06
395 0.06
396 0.07
397 0.07
398 0.07
399 0.06
400 0.07
401 0.08
402 0.09
403 0.1
404 0.14
405 0.15
406 0.16
407 0.17
408 0.16
409 0.16
410 0.15
411 0.12
412 0.07
413 0.06
414 0.05
415 0.04
416 0.05
417 0.05
418 0.05
419 0.05
420 0.05
421 0.05
422 0.05
423 0.05
424 0.05
425 0.05
426 0.05
427 0.04
428 0.04
429 0.04
430 0.05
431 0.05
432 0.06
433 0.1
434 0.13
435 0.14
436 0.16
437 0.17
438 0.18
439 0.2
440 0.22
441 0.24
442 0.22
443 0.24
444 0.22
445 0.22
446 0.21
447 0.19
448 0.15
449 0.1
450 0.08
451 0.05
452 0.05
453 0.05
454 0.04
455 0.05
456 0.05
457 0.05
458 0.05
459 0.05
460 0.05
461 0.05
462 0.07
463 0.08
464 0.09
465 0.09
466 0.11
467 0.11
468 0.13
469 0.15
470 0.14
471 0.12
472 0.14
473 0.14
474 0.16
475 0.18
476 0.17
477 0.16
478 0.15
479 0.15
480 0.15
481 0.17
482 0.15
483 0.13
484 0.12
485 0.11
486 0.1
487 0.1
488 0.07
489 0.04
490 0.04
491 0.04
492 0.04
493 0.05
494 0.07
495 0.08
496 0.1
497 0.16
498 0.19
499 0.21
500 0.21
501 0.24
502 0.24
503 0.25
504 0.3
505 0.25
506 0.24
507 0.26
508 0.28
509 0.26
510 0.27
511 0.27
512 0.24
513 0.33
514 0.39
515 0.43
516 0.51
517 0.61
518 0.67
519 0.76
520 0.83
521 0.8
522 0.81
523 0.8
524 0.77
525 0.69
526 0.61
527 0.56
528 0.47