Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165GM53

Protein Details
Accession A0A165GM53    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MDCQRARGGKRVSRRSEKREGCRDGVBasic
NLS Segment(s)
PositionSequence
9-15GKRVSRR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MDCQRARGGKRVSRRSEKREGCRDGVVQVQQPGRGRSSGRRCGCGCRCAMSHPTCSAFLSQQRTVCLQRQRPRGERREGSKPAAPYRTAFMAHAVHPCIPADASAHPGQGMPRIQESRRWLRQSSDSGEGHVSRPACGCASIRPSHMGQGIIEAQSKLLTQTRCDDESKDSIPGRLPTSEVKSWTIPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.84
4 0.86
5 0.86
6 0.85
7 0.83
8 0.75
9 0.7
10 0.63
11 0.54
12 0.51
13 0.44
14 0.37
15 0.36
16 0.34
17 0.33
18 0.35
19 0.35
20 0.31
21 0.3
22 0.3
23 0.34
24 0.42
25 0.48
26 0.48
27 0.52
28 0.52
29 0.59
30 0.62
31 0.57
32 0.49
33 0.44
34 0.42
35 0.4
36 0.46
37 0.39
38 0.38
39 0.35
40 0.35
41 0.31
42 0.31
43 0.28
44 0.24
45 0.25
46 0.28
47 0.28
48 0.27
49 0.28
50 0.31
51 0.32
52 0.35
53 0.38
54 0.41
55 0.46
56 0.53
57 0.59
58 0.65
59 0.72
60 0.73
61 0.73
62 0.71
63 0.68
64 0.69
65 0.65
66 0.6
67 0.55
68 0.5
69 0.46
70 0.43
71 0.38
72 0.29
73 0.27
74 0.25
75 0.22
76 0.18
77 0.16
78 0.14
79 0.15
80 0.16
81 0.15
82 0.13
83 0.13
84 0.12
85 0.1
86 0.08
87 0.07
88 0.07
89 0.07
90 0.1
91 0.1
92 0.1
93 0.1
94 0.11
95 0.11
96 0.13
97 0.14
98 0.11
99 0.15
100 0.18
101 0.18
102 0.24
103 0.3
104 0.36
105 0.42
106 0.45
107 0.43
108 0.43
109 0.49
110 0.49
111 0.47
112 0.44
113 0.36
114 0.34
115 0.35
116 0.32
117 0.27
118 0.24
119 0.2
120 0.14
121 0.15
122 0.15
123 0.13
124 0.13
125 0.13
126 0.15
127 0.21
128 0.22
129 0.23
130 0.25
131 0.26
132 0.28
133 0.29
134 0.25
135 0.19
136 0.2
137 0.2
138 0.18
139 0.19
140 0.15
141 0.14
142 0.13
143 0.13
144 0.12
145 0.15
146 0.15
147 0.17
148 0.23
149 0.28
150 0.31
151 0.33
152 0.33
153 0.33
154 0.37
155 0.37
156 0.37
157 0.33
158 0.32
159 0.35
160 0.36
161 0.34
162 0.29
163 0.3
164 0.29
165 0.35
166 0.38
167 0.36
168 0.36