Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X0I5

Protein Details
Accession G2X0I5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
99-120REPSPPPRRRHRGRSSHGHYRHBasic
NLS Segment(s)
PositionSequence
102-119SPPPRRRHRGRSSHGHYR
Subcellular Location(s) extr 11, mito 7, plas 6, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG vda:VDAG_03764  -  
Amino Acid Sequences MAPAHPFSGLPLVGRFALPASPASDLTPTKSFPLAVRDILKRQATTTVVAEPSDGNDGGTNLSGGEIAGIVIGSIVGVLLLFWIVRSCGMWGQPGLWGREPSPPPRRRHRGRSSHGHYRHQSTASRRRSPSHGRTSYEVRYSPNVMREKSRSPRRPDVVYDHRRGSLGRSRNYDYDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.11
4 0.12
5 0.11
6 0.11
7 0.11
8 0.12
9 0.13
10 0.14
11 0.17
12 0.17
13 0.21
14 0.22
15 0.21
16 0.22
17 0.22
18 0.22
19 0.2
20 0.25
21 0.23
22 0.25
23 0.29
24 0.31
25 0.33
26 0.38
27 0.39
28 0.33
29 0.31
30 0.32
31 0.28
32 0.27
33 0.25
34 0.22
35 0.2
36 0.19
37 0.19
38 0.14
39 0.14
40 0.13
41 0.12
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.05
49 0.05
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.01
63 0.01
64 0.01
65 0.01
66 0.01
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.04
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.1
81 0.12
82 0.13
83 0.14
84 0.14
85 0.15
86 0.22
87 0.24
88 0.29
89 0.37
90 0.43
91 0.47
92 0.57
93 0.66
94 0.68
95 0.76
96 0.79
97 0.79
98 0.8
99 0.84
100 0.82
101 0.82
102 0.8
103 0.78
104 0.71
105 0.66
106 0.62
107 0.55
108 0.52
109 0.51
110 0.55
111 0.55
112 0.6
113 0.56
114 0.56
115 0.61
116 0.66
117 0.66
118 0.67
119 0.64
120 0.59
121 0.62
122 0.64
123 0.61
124 0.56
125 0.48
126 0.4
127 0.38
128 0.39
129 0.37
130 0.39
131 0.4
132 0.37
133 0.41
134 0.44
135 0.49
136 0.55
137 0.63
138 0.64
139 0.67
140 0.76
141 0.76
142 0.76
143 0.73
144 0.72
145 0.72
146 0.72
147 0.7
148 0.63
149 0.58
150 0.54
151 0.48
152 0.45
153 0.43
154 0.43
155 0.44
156 0.47
157 0.51