Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165IJR6

Protein Details
Accession A0A165IJR6   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTLNQVRRGLRKRKPRPTPGSPQLLNHydrophilic
38-60FSEVKPKKPNSSKRKVARVRLTTHydrophilic
NLS Segment(s)
PositionSequence
8-17RGLRKRKPRP
42-54KPKKPNSSKRKVA
123-129VKKPKKP
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MTLNQVRRGLRKRKPRPTPGSPQLLNCPQRKAVCSKIFSEVKPKKPNSSKRKVARVRLTTGKSVMAYIMGEGHNLQEHSAVLVRGGRTQDLPGVKYKVVRGALDFSAVPNRVTARSKYGGSAVKKPKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.89
4 0.88
5 0.9
6 0.87
7 0.86
8 0.77
9 0.7
10 0.67
11 0.67
12 0.65
13 0.57
14 0.52
15 0.48
16 0.48
17 0.47
18 0.45
19 0.46
20 0.46
21 0.46
22 0.44
23 0.47
24 0.48
25 0.46
26 0.51
27 0.49
28 0.51
29 0.58
30 0.58
31 0.59
32 0.65
33 0.75
34 0.74
35 0.76
36 0.76
37 0.75
38 0.84
39 0.82
40 0.81
41 0.8
42 0.75
43 0.7
44 0.68
45 0.62
46 0.53
47 0.47
48 0.38
49 0.29
50 0.24
51 0.18
52 0.11
53 0.08
54 0.06
55 0.07
56 0.06
57 0.06
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.05
64 0.05
65 0.06
66 0.07
67 0.07
68 0.06
69 0.08
70 0.09
71 0.11
72 0.12
73 0.12
74 0.11
75 0.12
76 0.16
77 0.16
78 0.17
79 0.19
80 0.22
81 0.22
82 0.24
83 0.24
84 0.26
85 0.27
86 0.26
87 0.24
88 0.25
89 0.25
90 0.24
91 0.23
92 0.18
93 0.21
94 0.21
95 0.19
96 0.17
97 0.18
98 0.21
99 0.25
100 0.26
101 0.27
102 0.3
103 0.31
104 0.31
105 0.36
106 0.39
107 0.4
108 0.48
109 0.52