Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165EJJ3

Protein Details
Accession A0A165EJJ3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-46GKVKQQTPKVEKQEKKKKPKGRAKKRMLYNRRFVNBasic
NLS Segment(s)
PositionSequence
12-39GKVKQQTPKVEKQEKKKKPKGRAKKRML
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKQQTPKVEKQEKKKKPKGRAKKRMLYNRRFVNVTAAPGGKRRMNANPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.49
4 0.54
5 0.59
6 0.67
7 0.7
8 0.73
9 0.74
10 0.77
11 0.8
12 0.8
13 0.84
14 0.84
15 0.83
16 0.84
17 0.89
18 0.89
19 0.89
20 0.9
21 0.89
22 0.88
23 0.89
24 0.89
25 0.88
26 0.85
27 0.82
28 0.79
29 0.72
30 0.65
31 0.56
32 0.52
33 0.44
34 0.39
35 0.33
36 0.28
37 0.25
38 0.28
39 0.32
40 0.27
41 0.27
42 0.3
43 0.35