Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168B827

Protein Details
Accession A0A168B827    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
104-123SLAKRILWRKWIRNESNSRKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MTRKLVTKVKATYPSSFPDELPRPELQMVYFSAALMGGQVQGRPLKEMLLEGLRALGYSVVVIWPDRCRAAAARVESVRWDTPAFPVPLALFRLYVAAKETAPSLAKRILWRKWIRNESNSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.46
4 0.39
5 0.38
6 0.4
7 0.39
8 0.39
9 0.35
10 0.32
11 0.32
12 0.32
13 0.23
14 0.2
15 0.18
16 0.16
17 0.15
18 0.12
19 0.11
20 0.1
21 0.1
22 0.07
23 0.06
24 0.05
25 0.05
26 0.05
27 0.07
28 0.09
29 0.09
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.11
36 0.1
37 0.1
38 0.08
39 0.08
40 0.07
41 0.07
42 0.07
43 0.05
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.05
51 0.06
52 0.07
53 0.07
54 0.08
55 0.09
56 0.1
57 0.14
58 0.17
59 0.18
60 0.22
61 0.22
62 0.22
63 0.22
64 0.24
65 0.2
66 0.17
67 0.16
68 0.12
69 0.14
70 0.19
71 0.19
72 0.16
73 0.16
74 0.15
75 0.17
76 0.18
77 0.16
78 0.12
79 0.11
80 0.13
81 0.13
82 0.13
83 0.13
84 0.12
85 0.11
86 0.12
87 0.13
88 0.13
89 0.15
90 0.15
91 0.17
92 0.19
93 0.22
94 0.3
95 0.37
96 0.41
97 0.49
98 0.57
99 0.63
100 0.7
101 0.78
102 0.77
103 0.79