Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166WVD7

Protein Details
Accession A0A166WVD7   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-80LLPTITDKGKPKRKRADRESLDSTYHydrophilic
NLS Segment(s)
PositionSequence
64-70GKPKRKR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MYNHPPPSPLLNSYSTHDNLHDDDNDDDNDDDNDDDNDDDNDDDTDDDNDSTSSQLLPTITDKGKPKRKRADRESLDSTYAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.29
4 0.27
5 0.26
6 0.24
7 0.24
8 0.22
9 0.19
10 0.18
11 0.19
12 0.18
13 0.17
14 0.15
15 0.13
16 0.12
17 0.1
18 0.09
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.06
43 0.06
44 0.08
45 0.09
46 0.14
47 0.15
48 0.2
49 0.28
50 0.37
51 0.47
52 0.54
53 0.63
54 0.69
55 0.79
56 0.84
57 0.86
58 0.87
59 0.85
60 0.85
61 0.82
62 0.75