Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WR46

Protein Details
Accession G2WR46    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
195-222LFFTCCTGRVNRKRAERRKADYHSPPAVHydrophilic
NLS Segment(s)
PositionSequence
208-209RA
211-211R
Subcellular Location(s) plas 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
KEGG vda:VDAG_00029  -  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MGVLALVNHFGTFLLFLAMVLLIVSSITAPTVNSLSLFSVNLGSDSGDISFGTFGYCVHDVRGRGCSRTSIGYSPTSILREVDGTDFSDWTESTSKALTNVMILHPIGAGIAFVGFALSLGSSFFGSFLSSLVAGITFVVTVAALACDFVWMDLVRRRINRRDNGGNPDSHAYYDAALWCVLASAICSLLATIILFFTCCTGRVNRKRAERRKADYHSPPAVAHTRHHWWQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.06
6 0.06
7 0.05
8 0.05
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.04
17 0.06
18 0.07
19 0.08
20 0.08
21 0.09
22 0.1
23 0.11
24 0.11
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.08
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.09
43 0.1
44 0.1
45 0.12
46 0.16
47 0.16
48 0.18
49 0.26
50 0.23
51 0.24
52 0.25
53 0.25
54 0.24
55 0.26
56 0.27
57 0.21
58 0.23
59 0.22
60 0.22
61 0.21
62 0.21
63 0.19
64 0.17
65 0.14
66 0.12
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.1
73 0.1
74 0.09
75 0.09
76 0.08
77 0.09
78 0.11
79 0.09
80 0.1
81 0.1
82 0.1
83 0.1
84 0.11
85 0.09
86 0.08
87 0.09
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.06
94 0.05
95 0.04
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.03
131 0.02
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.05
138 0.05
139 0.07
140 0.11
141 0.15
142 0.19
143 0.24
144 0.3
145 0.38
146 0.47
147 0.51
148 0.56
149 0.61
150 0.62
151 0.66
152 0.64
153 0.56
154 0.49
155 0.45
156 0.38
157 0.29
158 0.24
159 0.16
160 0.13
161 0.14
162 0.13
163 0.11
164 0.1
165 0.09
166 0.08
167 0.07
168 0.07
169 0.05
170 0.05
171 0.04
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.07
185 0.07
186 0.08
187 0.11
188 0.17
189 0.28
190 0.38
191 0.47
192 0.53
193 0.64
194 0.74
195 0.82
196 0.86
197 0.85
198 0.84
199 0.86
200 0.85
201 0.84
202 0.83
203 0.81
204 0.76
205 0.68
206 0.6
207 0.55
208 0.55
209 0.47
210 0.41
211 0.39
212 0.41
213 0.46