Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168EQM2

Protein Details
Accession A0A168EQM2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-51LKSFRTKQKLAKSQKQNRPVPQHydrophilic
56-77RTNNSVRYNAKRRHWRKTKLGIHydrophilic
NLS Segment(s)
PositionSequence
66-73KRRHWRKT
Subcellular Location(s) mito 16.5, mito_nucl 13.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MLPPAVIISHMVNLNSRKWPMKNAFAEWSLKSFRTKQKLAKSQKQNRPVPQWIRLRTNNSVRYNAKRRHWRKTKLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.27
4 0.29
5 0.29
6 0.38
7 0.39
8 0.46
9 0.47
10 0.46
11 0.47
12 0.44
13 0.45
14 0.37
15 0.35
16 0.27
17 0.24
18 0.23
19 0.26
20 0.31
21 0.35
22 0.39
23 0.43
24 0.51
25 0.6
26 0.66
27 0.7
28 0.73
29 0.77
30 0.8
31 0.83
32 0.8
33 0.77
34 0.76
35 0.75
36 0.7
37 0.68
38 0.68
39 0.64
40 0.65
41 0.64
42 0.62
43 0.61
44 0.65
45 0.65
46 0.6
47 0.63
48 0.6
49 0.64
50 0.68
51 0.68
52 0.69
53 0.72
54 0.75
55 0.79
56 0.84
57 0.84