Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162N1G9

Protein Details
Accession A0A162N1G9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-112EKLAEKMHKKRIERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
50-108MKAKENEMKAEKKAERQRKVDAIREKRAKKEEKERYEKLAEKMHKKRIERLKRKEKRNK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTETTSIPEATQADKPLGKQWHAPKKAFRPTAGLTSYEKRTKERALMAQMKAKENEMKAEKKAERQRKVDAIREKRAKKEEKERYEKLAEKMHKKRIERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.29
4 0.32
5 0.31
6 0.35
7 0.44
8 0.51
9 0.56
10 0.59
11 0.6
12 0.65
13 0.73
14 0.69
15 0.6
16 0.56
17 0.52
18 0.54
19 0.47
20 0.4
21 0.33
22 0.34
23 0.38
24 0.36
25 0.35
26 0.31
27 0.34
28 0.34
29 0.35
30 0.36
31 0.35
32 0.39
33 0.44
34 0.44
35 0.44
36 0.43
37 0.41
38 0.36
39 0.33
40 0.27
41 0.2
42 0.24
43 0.24
44 0.24
45 0.23
46 0.3
47 0.3
48 0.36
49 0.45
50 0.49
51 0.52
52 0.53
53 0.57
54 0.59
55 0.62
56 0.62
57 0.63
58 0.61
59 0.63
60 0.69
61 0.67
62 0.66
63 0.7
64 0.7
65 0.67
66 0.7
67 0.71
68 0.73
69 0.78
70 0.74
71 0.72
72 0.72
73 0.69
74 0.63
75 0.61
76 0.59
77 0.6
78 0.65
79 0.69
80 0.69
81 0.67
82 0.71
83 0.73
84 0.77
85 0.78
86 0.8
87 0.82
88 0.84
89 0.92
90 0.94
91 0.94
92 0.93