Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162M415

Protein Details
Accession A0A162M415    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
332-358LPEPAERKEPRRKYRRALISQNRRDVFHydrophilic
NLS Segment(s)
PositionSequence
316-347RATLGKRKGMTSKPAALPEPAERKEPRRKYRR
Subcellular Location(s) nucl 15, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MTAPQLPTSKPLWHKQVEEMGLKGETLFTISRLNSASKIELPQFLMLRALYQPKSRLDLEKLFDHGAVTEETWSITKKCLGSCQEYMAYLRSISSEKEVLGPFEMARLYQKRSSELISNSESRREVDSSKITVQRRVTRSQTRAEQQGSPTPKPSEELPPRMEKLSLHTPKQQSGDGSSSPAGGDEPRYLFSPTCGTPIPPSIADKVYRFIEDEQIVNFALILLLDTLVLTSPYVEGFWSPYRSPFSVRDGAEEVYQARVDGVFRRERDLPGNMIAEVKPHSRSTNEMNVNMQESAQMAAWIAEYPQLDKQIALKRATLGKRKGMTSKPAALPEPAERKEPRRKYRRALISQNRRDVFITIGSYDEAYIDYITNVSQSEAFLEMKRYGPFEIVDPADMERLCHFLLALCIQGRILD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.63
4 0.6
5 0.56
6 0.48
7 0.42
8 0.36
9 0.33
10 0.26
11 0.18
12 0.12
13 0.12
14 0.11
15 0.1
16 0.15
17 0.15
18 0.18
19 0.19
20 0.21
21 0.21
22 0.23
23 0.25
24 0.24
25 0.28
26 0.28
27 0.29
28 0.29
29 0.32
30 0.3
31 0.27
32 0.26
33 0.21
34 0.2
35 0.2
36 0.25
37 0.23
38 0.27
39 0.31
40 0.32
41 0.37
42 0.38
43 0.4
44 0.4
45 0.45
46 0.44
47 0.43
48 0.43
49 0.4
50 0.37
51 0.31
52 0.25
53 0.19
54 0.16
55 0.13
56 0.11
57 0.1
58 0.1
59 0.11
60 0.13
61 0.12
62 0.13
63 0.17
64 0.19
65 0.2
66 0.28
67 0.32
68 0.36
69 0.37
70 0.4
71 0.37
72 0.36
73 0.35
74 0.29
75 0.25
76 0.18
77 0.16
78 0.13
79 0.13
80 0.13
81 0.15
82 0.14
83 0.14
84 0.18
85 0.19
86 0.18
87 0.18
88 0.18
89 0.14
90 0.15
91 0.15
92 0.1
93 0.16
94 0.18
95 0.21
96 0.24
97 0.26
98 0.28
99 0.3
100 0.32
101 0.32
102 0.31
103 0.32
104 0.32
105 0.35
106 0.33
107 0.34
108 0.33
109 0.28
110 0.28
111 0.26
112 0.23
113 0.24
114 0.27
115 0.28
116 0.32
117 0.38
118 0.36
119 0.4
120 0.45
121 0.47
122 0.48
123 0.5
124 0.52
125 0.55
126 0.57
127 0.58
128 0.59
129 0.54
130 0.56
131 0.53
132 0.48
133 0.42
134 0.45
135 0.44
136 0.38
137 0.38
138 0.33
139 0.31
140 0.29
141 0.29
142 0.31
143 0.33
144 0.37
145 0.37
146 0.41
147 0.42
148 0.41
149 0.39
150 0.29
151 0.28
152 0.33
153 0.34
154 0.33
155 0.38
156 0.39
157 0.43
158 0.44
159 0.4
160 0.3
161 0.28
162 0.28
163 0.22
164 0.21
165 0.18
166 0.16
167 0.14
168 0.13
169 0.1
170 0.07
171 0.08
172 0.08
173 0.08
174 0.09
175 0.11
176 0.12
177 0.11
178 0.12
179 0.14
180 0.13
181 0.14
182 0.13
183 0.13
184 0.13
185 0.15
186 0.16
187 0.13
188 0.14
189 0.14
190 0.15
191 0.17
192 0.16
193 0.17
194 0.16
195 0.16
196 0.15
197 0.14
198 0.16
199 0.15
200 0.15
201 0.13
202 0.13
203 0.12
204 0.11
205 0.1
206 0.05
207 0.04
208 0.04
209 0.03
210 0.02
211 0.02
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.04
223 0.04
224 0.07
225 0.09
226 0.12
227 0.12
228 0.15
229 0.19
230 0.19
231 0.23
232 0.23
233 0.26
234 0.3
235 0.3
236 0.3
237 0.29
238 0.29
239 0.25
240 0.23
241 0.18
242 0.12
243 0.12
244 0.09
245 0.07
246 0.07
247 0.07
248 0.1
249 0.14
250 0.19
251 0.19
252 0.23
253 0.25
254 0.27
255 0.3
256 0.29
257 0.27
258 0.25
259 0.25
260 0.22
261 0.21
262 0.19
263 0.16
264 0.16
265 0.16
266 0.15
267 0.15
268 0.17
269 0.16
270 0.2
271 0.25
272 0.32
273 0.34
274 0.33
275 0.33
276 0.33
277 0.34
278 0.3
279 0.24
280 0.15
281 0.11
282 0.11
283 0.09
284 0.08
285 0.06
286 0.06
287 0.06
288 0.06
289 0.06
290 0.08
291 0.08
292 0.1
293 0.12
294 0.14
295 0.14
296 0.14
297 0.21
298 0.26
299 0.31
300 0.31
301 0.3
302 0.32
303 0.4
304 0.47
305 0.49
306 0.46
307 0.49
308 0.51
309 0.54
310 0.58
311 0.55
312 0.56
313 0.54
314 0.57
315 0.53
316 0.52
317 0.5
318 0.44
319 0.41
320 0.41
321 0.43
322 0.37
323 0.39
324 0.39
325 0.46
326 0.56
327 0.63
328 0.66
329 0.68
330 0.75
331 0.78
332 0.85
333 0.88
334 0.86
335 0.87
336 0.87
337 0.88
338 0.88
339 0.89
340 0.79
341 0.7
342 0.62
343 0.52
344 0.43
345 0.35
346 0.28
347 0.19
348 0.19
349 0.18
350 0.17
351 0.15
352 0.13
353 0.09
354 0.08
355 0.08
356 0.07
357 0.07
358 0.07
359 0.07
360 0.08
361 0.08
362 0.08
363 0.08
364 0.08
365 0.09
366 0.12
367 0.13
368 0.14
369 0.17
370 0.18
371 0.21
372 0.23
373 0.23
374 0.21
375 0.22
376 0.22
377 0.2
378 0.24
379 0.22
380 0.22
381 0.21
382 0.21
383 0.23
384 0.22
385 0.21
386 0.16
387 0.18
388 0.17
389 0.16
390 0.14
391 0.12
392 0.16
393 0.16
394 0.19
395 0.17
396 0.17