Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168BUG6

Protein Details
Accession A0A168BUG6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
199-223AAEAKPPKPKKIKAKKELEAGKNKWBasic
NLS Segment(s)
PositionSequence
202-223AKPPKPKKIKAKKELEAGKNKW
Subcellular Location(s) nucl 14.5, cyto 10, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSGLAELEVERGLYQEQPSPQLDLVLAQLRDDPDNAELKNLEQELKNFVDLLNENIAELKPKQAPKPTSKQPSPPPEPEKWSRENHPAFKKAAPPPPEEKDDTPVAYQVNDTVMAKWMSGDKGLYPAKITSITGSAAAPVYVVKFKSYDNTETLRSRDIRPISNKRKAEAPPPPPLASTPGLVSSAGATTYPTAGKDAAAEAKPPKPKKIKAKKELEAGKNKWQEFNSKSKFGKTQKKDSMFRTPEGIRGRVGFTGSGQAMRKDPSRNRHVYQVNEDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.17
3 0.19
4 0.24
5 0.25
6 0.27
7 0.26
8 0.25
9 0.23
10 0.18
11 0.2
12 0.21
13 0.19
14 0.16
15 0.19
16 0.2
17 0.21
18 0.2
19 0.18
20 0.15
21 0.2
22 0.19
23 0.19
24 0.18
25 0.18
26 0.22
27 0.22
28 0.21
29 0.19
30 0.2
31 0.23
32 0.24
33 0.23
34 0.19
35 0.18
36 0.2
37 0.18
38 0.2
39 0.18
40 0.16
41 0.16
42 0.17
43 0.17
44 0.15
45 0.15
46 0.17
47 0.19
48 0.24
49 0.29
50 0.37
51 0.44
52 0.49
53 0.58
54 0.64
55 0.68
56 0.69
57 0.72
58 0.73
59 0.76
60 0.75
61 0.75
62 0.71
63 0.66
64 0.68
65 0.67
66 0.64
67 0.59
68 0.57
69 0.53
70 0.57
71 0.59
72 0.61
73 0.61
74 0.59
75 0.56
76 0.54
77 0.56
78 0.53
79 0.54
80 0.49
81 0.46
82 0.48
83 0.5
84 0.51
85 0.47
86 0.42
87 0.38
88 0.36
89 0.32
90 0.26
91 0.24
92 0.19
93 0.16
94 0.14
95 0.1
96 0.09
97 0.09
98 0.09
99 0.07
100 0.09
101 0.09
102 0.09
103 0.09
104 0.1
105 0.09
106 0.09
107 0.09
108 0.07
109 0.13
110 0.14
111 0.14
112 0.13
113 0.13
114 0.13
115 0.14
116 0.14
117 0.08
118 0.09
119 0.09
120 0.08
121 0.08
122 0.07
123 0.07
124 0.06
125 0.05
126 0.04
127 0.05
128 0.06
129 0.06
130 0.06
131 0.07
132 0.07
133 0.12
134 0.15
135 0.16
136 0.18
137 0.2
138 0.23
139 0.24
140 0.25
141 0.25
142 0.24
143 0.24
144 0.27
145 0.28
146 0.31
147 0.38
148 0.47
149 0.53
150 0.6
151 0.59
152 0.54
153 0.58
154 0.54
155 0.54
156 0.52
157 0.49
158 0.48
159 0.51
160 0.5
161 0.44
162 0.43
163 0.38
164 0.3
165 0.25
166 0.17
167 0.14
168 0.14
169 0.13
170 0.12
171 0.08
172 0.07
173 0.07
174 0.06
175 0.05
176 0.05
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.08
184 0.1
185 0.13
186 0.13
187 0.15
188 0.17
189 0.23
190 0.31
191 0.34
192 0.41
193 0.45
194 0.54
195 0.62
196 0.71
197 0.76
198 0.78
199 0.86
200 0.83
201 0.84
202 0.85
203 0.82
204 0.81
205 0.75
206 0.74
207 0.71
208 0.66
209 0.61
210 0.53
211 0.53
212 0.48
213 0.54
214 0.5
215 0.51
216 0.52
217 0.52
218 0.6
219 0.61
220 0.67
221 0.64
222 0.68
223 0.71
224 0.78
225 0.79
226 0.76
227 0.78
228 0.71
229 0.65
230 0.61
231 0.52
232 0.5
233 0.5
234 0.45
235 0.36
236 0.33
237 0.34
238 0.28
239 0.28
240 0.21
241 0.17
242 0.21
243 0.2
244 0.23
245 0.22
246 0.23
247 0.24
248 0.28
249 0.32
250 0.35
251 0.43
252 0.48
253 0.56
254 0.62
255 0.63
256 0.69
257 0.71
258 0.69
259 0.69