Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162ICE4

Protein Details
Accession A0A162ICE4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-124GERPPPTNVKQPPKRPKPVPLPWKIRQKPHydrophilic
NLS Segment(s)
PositionSequence
105-123KQPPKRPKPVPLPWKIRQK
Subcellular Location(s) extr 21, plas 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008427  Extracellular_membr_CFEM_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05730  CFEM  
Amino Acid Sequences MKAAVVLVSVVGLVAAIITPPWVPGCSRPCLGKPIDNSGCRTTDMRCLCQDFVIDKIVNQAWPCIAGKCGIFDQVQVHRKLRFHFCRWPNMVEPPGERPPPTNVKQPPKRPKPVPLPWKIRQKPSKTQSTPIPTPTPSAGGRGVDDEAALDAGSDEVAVDGGELDNVAPDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.04
7 0.05
8 0.06
9 0.07
10 0.08
11 0.16
12 0.21
13 0.25
14 0.27
15 0.31
16 0.32
17 0.37
18 0.4
19 0.38
20 0.37
21 0.42
22 0.48
23 0.46
24 0.48
25 0.45
26 0.43
27 0.39
28 0.37
29 0.29
30 0.3
31 0.31
32 0.3
33 0.3
34 0.32
35 0.31
36 0.31
37 0.3
38 0.23
39 0.2
40 0.21
41 0.18
42 0.14
43 0.17
44 0.17
45 0.17
46 0.16
47 0.15
48 0.1
49 0.12
50 0.13
51 0.1
52 0.09
53 0.09
54 0.09
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.14
61 0.2
62 0.26
63 0.26
64 0.28
65 0.28
66 0.3
67 0.33
68 0.4
69 0.39
70 0.39
71 0.46
72 0.47
73 0.53
74 0.54
75 0.53
76 0.46
77 0.43
78 0.4
79 0.32
80 0.3
81 0.27
82 0.28
83 0.26
84 0.24
85 0.22
86 0.26
87 0.32
88 0.33
89 0.36
90 0.4
91 0.5
92 0.58
93 0.67
94 0.73
95 0.75
96 0.81
97 0.77
98 0.78
99 0.78
100 0.79
101 0.79
102 0.78
103 0.77
104 0.76
105 0.83
106 0.78
107 0.78
108 0.77
109 0.75
110 0.75
111 0.74
112 0.77
113 0.7
114 0.7
115 0.69
116 0.69
117 0.65
118 0.59
119 0.56
120 0.45
121 0.45
122 0.4
123 0.36
124 0.27
125 0.27
126 0.24
127 0.2
128 0.2
129 0.19
130 0.19
131 0.15
132 0.14
133 0.11
134 0.09
135 0.08
136 0.07
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04