Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167BY55

Protein Details
Accession A0A167BY55   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-102ASAHKDKKSKDEKSSKGKDKASSTHREKSSKSSKGKEKEKGNBasic
NLS Segment(s)
PositionSequence
40-102KSSAHKDKPSKDEESSKGKEKASAHKDKKSKDEKSSKGKDKASSTHREKSSKSSKGKEKEKGN
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLLTFKEGWTWSEEHQNYFRYLDNGTCELRRNKAGESSSKSSAHKDKPSKDEESSKGKEKASAHKDKKSKDEKSSKGKDKASSTHREKSSKSSKGKEKEKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.36
4 0.34
5 0.33
6 0.33
7 0.24
8 0.23
9 0.21
10 0.21
11 0.22
12 0.22
13 0.22
14 0.26
15 0.27
16 0.3
17 0.31
18 0.29
19 0.27
20 0.32
21 0.33
22 0.35
23 0.39
24 0.4
25 0.41
26 0.42
27 0.41
28 0.4
29 0.43
30 0.43
31 0.44
32 0.47
33 0.49
34 0.52
35 0.56
36 0.55
37 0.51
38 0.5
39 0.46
40 0.47
41 0.44
42 0.44
43 0.43
44 0.39
45 0.41
46 0.38
47 0.43
48 0.44
49 0.52
50 0.52
51 0.56
52 0.62
53 0.61
54 0.68
55 0.68
56 0.67
57 0.66
58 0.7
59 0.71
60 0.76
61 0.82
62 0.81
63 0.8
64 0.77
65 0.74
66 0.69
67 0.69
68 0.67
69 0.67
70 0.64
71 0.65
72 0.67
73 0.65
74 0.62
75 0.63
76 0.66
77 0.65
78 0.67
79 0.68
80 0.71
81 0.76
82 0.84